Protein
MCA_04936_1
Length
214 amino acids
Gene name: ATP5
Description: ATP synthase subunit 5, mitochondrial
Browser: contigC:4470956-4471680-
RNA-seq: read pairs 40324, FPKM 2317.4, percentile rank 98.0% (100% = highest expression)
Protein function
| Annotation: | ATP5 | ATP synthase subunit 5, mitochondrial | |
|---|---|---|---|
| KEGG: | K02137 | ATPeF0O | F-type H+-transporting ATPase subunit O |
| EGGNOG: | 0PNEN | ATP5 | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a ATP6 static relative to the rotary elements |
| SGD closest match: | S000002706 | ATP5 | ATP synthase subunit 5, mitochondrial |
| CGD closest match: | CAL0000190613 | ATP5 | F1F0 ATP synthase subunit 5 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XJS9_GEOCN | 65.89% | 214 | 8e-97 | Similar to Saccharomyces cerevisiae YDR298C ATP5 Subunit 5 of the stator stalk of mitochondrial F1F0 ATP synthase OS=Geotrichum candidum GN=BN980_GECA23s01220g PE=3 SV=1 |
| MIA_04393_1 | 69.52% | 187 | 9e-83 | MIA_04393_1 |
| A0A161HLY7_9ASCO | 56.81% | 213 | 4e-80 | F1F0 ATP synthase subunit 5 OS=Sugiyamaella lignohabitans GN=ATP5 PE=3 SV=1 |
| A0A060T3B9_BLAAD | 57.97% | 207 | 5e-78 | ARAD1C31570p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C31570g PE=3 SV=1 |
| A0A1E4TAH7_9ASCO | 56.22% | 201 | 7e-76 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_27658 PE=3 SV=1 |
| Q6C9B1_YARLI | 55.35% | 215 | 2e-71 | YALI0D12584p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D12584g PE=3 SV=2 |
| A0A1E3PLD1_9ASCO | 55.00% | 200 | 2e-71 | F-type H+-transporting ATPase oligomycin sensitivity conferral protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_24076 PE=3 SV=1 |
| UniRef50_A0A0H5C7Q2 | 53.77% | 199 | 3e-64 | ATP5 protein n=16 Tax=Saccharomycetales TaxID=4892 RepID=A0A0H5C7Q2_CYBJA |
| Q5A7P7_CANAL | 46.80% | 203 | 1e-61 | F1F0 ATP synthase subunit 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATP5 PE=3 SV=1 |
| ATPO_YEAST | 45.21% | 188 | 3e-52 | ATP synthase subunit 5, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP5 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9991
Predicted cleavage: 18
Protein family membership
- ATPase, OSCP/delta subunit (IPR000711)
Domains and repeats
-
Domain
1
20
40
60
80
100
120
140
160
180
200
214
Detailed signature matches
Protein sequence
>MCA_04936_1 MYSLRLARQTIRPMVRTMATAAKDNTSPPVQLFGLDGSYASALYTAAAKSNTLSSTESALSSIKNLLSQDSKIEQILSNP ALSAKDKESVVNVITSAVKGDATVKNFLNVLAENNRLSILASVADKFETLTNAAKGIVEATITSATPLDNKTIKALTASI NKSSFAKNASNLKVNNKVNPDILGGLIVEVGDRTVDLSVSSKIAKLNKLLTDDI
GO term prediction
Biological Process
GO:0015986 ATP synthesis coupled proton transport
Molecular Function
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
Cellular Component
GO:0016020 membrane