Protein
MCA_04926_1
Length
122 amino acids
Gene name: PKR1
Description: V-type ATPase assembly factor PKR1
Browser: contigC:4444357-4444726+
RNA-seq: read pairs 589, FPKM 59.2, percentile rank 69.0% (100% = highest expression)
Protein function
Annotation: | PKR1 | V-type ATPase assembly factor PKR1 | |
---|---|---|---|
EGGNOG: | 0PRWV | PKR1 | ER membrane protein (Pkr1) |
SGD closest match: | S000004730 | PKR1 | V-type ATPase assembly factor PKR1 |
CGD closest match: | CAL0000183006 | CAALFM_CR03430WA | Uncharacterized protein |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
UniRef50_A0A1E3QDL9 | 53.62% | 69 | 5e-20 | Uncharacterized protein (Fragment) n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A1E3QDL9_LIPST |
A0A0J9XCT8_GEOCN | 47.11% | 121 | 5e-22 | Similar to Saccharomyces cerevisiae YMR123W PKR1 V-ATPase assembly factor OS=Geotrichum candidum GN=BN980_GECA09s03860g PE=4 SV=1 |
PKR1_YEAST | 38.66% | 119 | 6e-19 | V-type ATPase assembly factor PKR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKR1 PE=1 SV=1 |
MIA_00571_1 | 54.79% | 73 | 2e-18 | MIA_00571_1 |
A0A060SYB7_BLAAD | 50.00% | 72 | 3e-17 | ARAD1A19690p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A19690g PE=4 SV=1 |
A0A1D8PSF9_CANAL | 42.02% | 119 | 9e-16 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR03430WA PE=4 SV=1 |
A0A1E4TDY6_9ASCO | 48.48% | 66 | 1e-15 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_24012 PE=4 SV=1 |
A0A1E3PM69_9ASCO | 52.17% | 69 | 6e-15 | Pkr1-domain-containing protein (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_9739 PE=4 SV=1 |
B5RSM4_YARLI | 47.83% | 69 | 3e-13 | YALI0F30004p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F30004g PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.7035
Protein family membership
- V-type ATPase assembly factor Pkr1 (IPR013945)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
-
mobidb-lite (disord...)
Protein sequence
>MCA_04926_1 MASVIKFFSDLWESVFTPGVTPVLIQATHLSFGSLLAVLIFLLVSTGSFHFIILIALATGLWAAITWFVDEINKMEEAEK QKKLKLEESKASDSTVETNNTDSAKATGTEEAINAKTRSKKV
GO term prediction
Biological Process
GO:0070072 vacuolar proton-transporting V-type ATPase complex assembly
Molecular Function
None predicted.
Cellular Component
None predicted.