Protein

MCA_04912_1

Length
108 amino acids


Browser: contigC:4400994-4402492-

RNA-seq: read pairs 6291, FPKM 713.1, percentile rank 95.5% (100% = highest expression)

Protein function

KEGG:K08513VAMP4 vesicle-associated membrane protein 4
EGGNOG:0PR0DFG08537.1vesicle-associated membrane protein 4
SGD closest match:S000005854SNC2Synaptobrevin homolog 2
CGD closest match:CAL0000176237orf19.5006.1SNAP receptor

Protein alignments

%idAln lengthE-value
MIA_04934_179.46%1123e-48MIA_04934_1
A0A1E3PGY5_9ASCO71.05%1141e-44Synaptobrevin OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_70969 PE=4 SV=1
A0A0J9XE62_GEOCN69.83%1162e-44Similar to Saccharomyces cerevisiae YOR327C SNC2 v-SNARE involved in the fusion between Golgi-derived secretory vesicles with the plasma membrane OS=Geotrichum candidum GN=BN980_GECA11s03156g PE=4 SV=1
A0A060TIZ2_BLAAD70.54%1123e-44ARAD1D42526p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D42526g PE=4 SV=1
UniRef50_G8YTL664.86%1113e-36Piso0_000297 protein n=11 Tax=Dikarya TaxID=451864 RepID=G8YTL6_PICSO
A0A1D8PFS0_CANAL65.77%1117e-40SNAP receptor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5006.1 PE=4 SV=1
A0A1E4TAA2_9ASCO66.29%896e-39Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_127526 PE=4 SV=1
Q6C7I4_YARLI65.17%899e-37YALI0E00594p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E00594g PE=4 SV=1
SNC2_YEAST55.65%1156e-36Synaptobrevin homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNC2 PE=1 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0006

Protein family membership

Domains and repeats

  1. Domain
1 10 20 30 40 50 60 70 80 90 100 108

Detailed signature matches

    1. PIRSF005409 (VAMP-5...)
    1. PF00957 (Synaptobrevin)
    2. PR00219 (SYNAPTOBREVN)
    3. PS50892 (V_SNARE)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF58038 (SNARE fus...)
  2. TRANSMEMBRANE (Tran...)
  3. cd15874 (R-SNARE_Snc1)
  4. mobidb-lite (disord...)

Residue annotation

  1. heterotetramer int...
  2. zero layer cd15874

Protein sequence

>MCA_04912_1
MASSVPYDPYIPSQQTGTSKTQDIQNQVDGTVDIMRQNLNLMAERGGQLDALQDKTDNLAVAAKDFQRGASRVRKQMWWK
DMKMRLCLLAGVIILIIVIVVPIAVHFS

GO term prediction

Biological Process

GO:0016192 vesicle-mediated transport

Molecular Function

None predicted.

Cellular Component

GO:0016021 integral component of membrane