Protein

MCA_04902_1

Length
429 amino acids

Browser: contigC:4378486-4379837-

RNA-seq: read pairs 577, FPKM 16.6, percentile rank 36.4% (100% = highest expression)

Protein function

KEGG:K00773tgt queuine tRNA-ribosyltransferase [EC:2.4.2.29]
EGGNOG:0PHFCFG05638.1Exchanges the guanine residue with 7-aminomethyl-7- deazaguanine in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). After this exchange, a cyclopentendiol moiety is attached to the 7-aminomethyl group of 7-deazaguanine, resulting in the hypermodified nucleoside queuosine (Q) (7-(((4,5-cis- dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine) (By similarity)

Protein alignments

%idAln lengthE-value
MIA_05215_180.68%4090.0MIA_05215_1
A0A167DG93_9ASCO78.62%4070.0Queuine tRNA-ribosyltransferase catalytic subunit 1 OS=Sugiyamaella lignohabitans GN=AWJ20_1160 PE=3 SV=1
A0A060T424_BLAAD79.10%4020.0Queuine tRNA-ribosyltransferase catalytic subunit 1 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C45232g PE=3 SV=1
Q6C2C9_YARLI78.41%4030.0Queuine tRNA-ribosyltransferase catalytic subunit 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F08921g PE=3 SV=1
UniRef50_Q6C2C978.41%4030.0Queuine tRNA-ribosyltransferase catalytic subunit 1 n=46 Tax=Eukaryota TaxID=2759 RepID=Q6C2C9_YARLI
A0A1E3PM59_9ASCO75.79%4090.0Queuine tRNA-ribosyltransferase catalytic subunit 1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_58721 PE=3 SV=1
A0A0J9X7Y8_GEOCN82.04%3730.0Queuine tRNA-ribosyltransferase catalytic subunit 1 OS=Geotrichum candidum GN=BN980_GECA05s00219g PE=3 SV=1
A0A1E4TH21_9ASCO69.70%4060.0Queuine tRNA-ribosyltransferase catalytic subunit 1 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_24300 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0431

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 350 400 429

Detailed signature matches

  1. Family IPR004803
    tRNA-guanine transglycosylase
    1. TIGR00430
    2. MF_00168 (Q_tRNA_Tgt)
  2. Domain IPR002616
    tRNA-guanine(15) transglycosylase-like
    1. PF01702 (TGT)
    2. TIGR00449
    3. SSF51713 (tRNA-guan...)
    4. G3DSA:3.20.20...

Protein sequence

>MCA_04902_1
MTETQLSNSDMNATVKNTFSKAGNSLNFEVLKKCSRSKARAANMTLPHGTVQTPMFMPVATQASLKGITPEQLDQLDCKI
CLNNTYHLGLKPGQSVLDSVGGAHKLQSWNRNILTDSGGFQMVSLLKLATITEEGVNFLSPHDGTPMLLTPEHSISLQNS
IGSDIMMQLDDVVATLTTGPRVEEAMLRSIRWLDRCIEANKNPDTQNLFAIIQGGLDLKLREKCCEEMIKRDTPGIAIGG
LSGGEDKESYCKVVDRCTDLLPENKPRYCMGVGYAEDLVVSVALGADLFDCVYPTRTARFGNAITRYGTINLKNRQYQDD
FTPIEKGCKCPVCRAKDELDKNGNPGMGMTRAMIAHLVSKETVGAHLLTLHNVHYQLNLMREAREAILRDEYDQYVIKFF
HDLYDGDKSKYPQWAIDALKKVNIDLISN

GO term prediction

Biological Process

GO:0006400 tRNA modification
GO:0101030 tRNA-guanine transglycosylation

Molecular Function

GO:0008479 queuine tRNA-ribosyltransferase activity
GO:0016763 transferase activity, transferring pentosyl groups

Cellular Component

None predicted.