Protein
MCA_04876_1
Length
201 amino acids
Gene name: YOP1
Description: Protein YOP1
Browser: contigC:4309167-4310176+
RNA-seq: read pairs 34401, FPKM 2104.3, percentile rank 97.8% (100% = highest expression)
Protein function
Annotation: | YOP1 | Protein YOP1 | |
---|---|---|---|
KEGG: | K17279 | REEP5_6 | receptor expression-enhancing protein 5/6 |
EGGNOG: | 0PP88 | YOP1 | membrane biogenesis protein Yop1 |
SGD closest match: | S000006232 | YOP1 | Protein YOP1 |
CGD closest match: | CAL0000201885 | orf19.2168.3 | Protein YOP1 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_03449_1 | 70.56% | 197 | 6e-101 | MIA_03449_1 |
A0A0J9XEN1_GEOCN | 64.62% | 195 | 6e-92 | Protein YOP1 OS=Geotrichum candidum GN=BN980_GECA12s03024g PE=3 SV=1 |
A0A060T8U1_BLAAD | 60.56% | 180 | 1e-75 | Protein YOP1 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D13926g PE=3 SV=1 |
YOP1_YARLI | 55.38% | 186 | 4e-67 | Protein YOP1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YOP1 PE=3 SV=2 |
A0A1E3PNG6_9ASCO | 52.06% | 194 | 9e-67 | Protein YOP1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_33525 PE=3 SV=1 |
A0A1E4TFD8_9ASCO | 52.87% | 157 | 9e-60 | Protein YOP1 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_106338 PE=3 SV=1 |
UniRef50_A0A0X8HS70 | 45.08% | 193 | 2e-53 | Protein YOP1 n=4 Tax=Saccharomycetales TaxID=4892 RepID=A0A0X8HS70_9SACH |
YOP1_YEAST | 42.35% | 196 | 7e-53 | Protein YOP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOP1 PE=1 SV=3 |
A0A1D8PI76_CANAL | 47.65% | 170 | 1e-42 | Protein YOP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2168.3 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1166
Protein family membership
- TB2/DP1/HVA22-related protein (IPR004345)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF03134 (TB2_DP1_HVA22)
-

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_04876_1 MTFSSDFQDKIHAHLNTVDKELDNYPALKKLESQTGVPKSYGVIGFVAVYFLLIFLNIGGIGQLLSNFAALVIPGYYSLQ ALETSSSADDTQFLTYWVVYAVFSVLEFWSRTILYYIPFYWVFKTVFFLYIGLPQFGGSKYLYVNFIRPFSVKVLGITGA PVPTPKSTEPAVPSTTSAGLKEKIDLATEDIASTTGASVHI
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.