Protein

MCA_04872_1

Length
421 amino acids


Gene name: ARC1

Description: tRNA-aminoacylation cofactor ARC1

Browser: contigC:4299990-4301518-

RNA-seq: read pairs 10562, FPKM 309.3, percentile rank 92.0% (100% = highest expression)

Protein function

Annotation:ARC1tRNA-aminoacylation cofactor ARC1
KEGG:K15437AIMP1 aminoacyl tRNA synthase complex-interacting multifunctional protein 1
EGGNOG:0PIC3ARC1cofactor for methionyl- and glutamyl-tRNA
SGD closest match:S000003073ARC1tRNA-aminoacylation cofactor ARC1
CGD closest match:CAL0000195614ARC1Arc1p

Protein alignments

%idAln lengthE-value
MIA_03428_190.75%1734e-112MIA_03428_1
A0A0J9XHN0_GEOCN84.48%1742e-105Similar to Saccharomyces cerevisiae YGL105W ARC1 Protein that binds tRNA and methionyl-and glutamyl-tRNA synthetases (Mes1p and Gus1p) OS=Geotrichum candidum GN=BN980_GECA15s01418g PE=4 SV=1
A0A167D9W4_9ASCO82.08%1733e-98Arc1p OS=Sugiyamaella lignohabitans GN=ARC1 PE=4 SV=1
A0A060T1H7_BLAAD75.00%1729e-87ARAD1A00638p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A00638g PE=4 SV=1
UniRef50_A0A0J9XHA670.69%1748e-84Similar to Saccharomyces cerevisiae YGL105W ARC1 Protein that binds tRNA and methionyl-and glutamyl-tRNA synthetases (Mes1p and Gus1p) n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XHA6_GEOCN
Q6C763_YARLI71.68%1732e-81YALI0E03432p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E03432g PE=4 SV=1
A0A1D8PSC8_CANAL67.63%1732e-80Arc1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARC1 PE=4 SV=1
A0A1E4TM78_9ASCO70.76%1716e-80Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_1434 PE=4 SV=1
ARC1_YEAST66.67%1716e-74tRNA-aminoacylation cofactor ARC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARC1 PE=1 SV=2
A0A1E3PJV3_9ASCO82.64%1214e-68Uncharacterized protein (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82696 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9670
Predicted cleavage: 20

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 350 421

Detailed signature matches

    1. SSF47616 (GST C-ter...)
    1. SSF50249 (Nucleic a...)
    1. PF01588 (tRNA_bind)
    2. PS50886 (TRBD)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd02799 (tRNA_bind_...)
  2. cd10304 (GST_C_Arc1...)
  3. mobidb-lite (disord...)

Residue annotation

  1. MetRS interface cd...
  2. GluRS interface cd...
  3. cytokine-active he...
  4. putative tRNA-bind...

Protein sequence

>MCA_04872_1
MFSRAFQRQLVSCSGLLRRPTIALSTNISKPLVTKLKLTEQAYFHQSNKMSSSIASLSTLFKGLSITDSSNNDEIVKELS
SKFPQLSKEQEAEQSQWLTLSNRFPESIADLNETLKQRTYLLNTSEPSLADAVVFSRVAPIVSKWGKDEIVASRHVVRWA
DLIQNSLNVSEDEKIKVDLDLAAPREIKPKPEKKKAAAPEENNKKAESKKGKKQEASPVAAAPEAKKDGEKKEKKEKKKK
EKKPQPAKVEVPVTPGMIDLRVGHIQKAVKHPDADSLYVSTIDMGDPEGPRTVCSGLVKYFPLEAMQDRYVVVVANLKPV
NMRGIKSSAMVLCASNEDTVEFVNPPEGSKPGDKIFFETYDLTPEPVLNPKKKIWEQIQPGFTTTEDLSVVYRKEGDSDK
KLVNKEGKLCKVNSLVAANVR

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0000049 tRNA binding

Cellular Component

None predicted.