Protein

MCA_04868_1

Length
149 amino acids

Gene name: RPL28

Description: 60S ribosomal protein L28

Browser: contigC:4294446-4295226-

RNA-seq: read pairs 55602, FPKM 4580.1, percentile rank 99.5% (100% = highest expression)

Protein function

Annotation:RPL2860S ribosomal protein L28
KEGG:K02900RP-L27Ae large subunit ribosomal protein L27Ae
EGGNOG:0PMZGRPL2860S ribosomal protein L28
SGD closest match:S000003071RPL2860S ribosomal protein L28
CGD closest match:CAL0000198266RPL28Ribosomal 60S subunit protein L28

Protein alignments

%idAln lengthE-value
MIA_03424_193.96%1498e-102MIA_03424_1
Q6CDU7_YARLI84.56%1495e-92YALI0B21076p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B21076g PE=3 SV=1
A0A1E3PJS9_9ASCO81.21%1492e-90Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_74106 PE=3 SV=1
RL28_YEAST81.21%1493e-9060S ribosomal protein L28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL28 PE=1 SV=3
UniRef50_P0240681.21%1496e-8760S ribosomal protein L28 n=217 Tax=Eukaryota TaxID=2759 RepID=RL28_YEAST
A0A0F7RSH3_GEOCN82.55%1493e-87Similar to Saccharomyces cerevisiae YGL103W RPL28 Ribosomal protein of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA14s02298g PE=3 SV=1
A0A1D8PSC5_CANAL78.52%1495e-85Ribosomal 60S subunit protein L28 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL28 PE=3 SV=1
A0A060T8D1_BLAAD79.87%1496e-82ARAD1D10296p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D10296g PE=3 SV=1
A0A1E4TDM4_9ASCO71.14%1494e-73Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_32942 PE=3 SV=1
A0A167DQ24_9ASCO76.72%1163e-61Ribosomal 60S subunit protein L28 OS=Sugiyamaella lignohabitans GN=RPL28 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9073
Predicted cleavage: 34

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 149

Detailed signature matches

  1. Family IPR030878
    Ribosomal protein L15
    1. MF_01341 (Ribosomal...)
  2. Domain IPR021131
    Ribosomal protein L18e/L15P
    1. PF00828 (Ribosomal_...)
    2. SSF52080 (Ribosomal...)
  3. SITE IPR001196
    Ribosomal protein L15, conserved site
    1. PS00475 (RIBOSOMAL_L15)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.100.1...
  2. G3DSA:4.10.99...
  3. mobidb-lite (disord...)

Protein sequence

>MCA_04868_1
MPTRFSKTRKHRGHVSAGYGRIGKHRKNPGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRYFHKQQNHFWRPVINVERLWS
LIPEEKREKYLKEASPSSAPVIDTLAAGYGKVLGKGAIPNVPVIVKARFVSAEAEQKIKEAGGVVELVA

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome
GO:0015934 large ribosomal subunit