Protein

MCA_04846_2

Length
102 amino acids


Description: centromere protein with CENP-S/Mhf1-like protein

Browser: contigC:4233397-4233915-

RNA-seq: read pairs 168, FPKM 20.2, percentile rank 41.6% (100% = highest expression)

Protein function

Annotation:centromere protein with CENP-S/Mhf1-like protein
EGGNOG:0PR25FG07161.1conserved hypothetical protein
SGD closest match:S000007626MHF1MHF histone-fold complex subunit 1
CGD closest match:CAL0000187076MHF1MHF histone-fold complex subunit 1

Protein alignments

%idAln lengthE-value
A0A0J9XFZ7_GEOCN46.15%916e-28Similar to Saccharomyces cerevisiae YOL086W-A MHF1 Component of the heterotetrameric MHF histone-fold complex OS=Geotrichum candidum GN=BN980_GECA12s02870g PE=4 SV=1
UniRef50_A0A1D2JH8350.00%926e-22Uncharacterized protein n=6 Tax=Onygenales TaxID=33183 RepID=A0A1D2JH83_PARBR
A0A1E3PSS1_9ASCO41.67%841e-23Uncharacterized protein (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_44593 PE=4 SV=1
A0A060SZ59_BLAAD34.83%893e-17ARAD1A17798p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A17798g PE=4 SV=1
MHF1_YEAST34.57%812e-12MHF histone-fold complex subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MHF1 PE=1 SV=1
MIA_04852_143.06%721e-11MIA_04852_1
B5FVB2_YARLI34.94%835e-11YALI0B06105p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B06105g PE=4 SV=1
MHF1_CANAL25.23%1072e-09MHF histone-fold complex subunit 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MHF1 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0775

Protein family membership

Domains and repeats

  1. Domain
1 10 20 30 40 50 60 70 80 90 102

Detailed signature matches

    1. PF15630 (CENP-S)
    1. SSF47113 (Histone-fold)
Unintegrated signatures no IPR
Unintegrated signatures

Protein sequence

>MCA_04846_2
MSSEDVDKAALVTRLQSALWFTIDQIVQKECKKLGCSYSPEFVVGLTKLVYNRILGAGTDLEAFARHAGRETITIEDVLL
LCRGVNGLGQILSESIEGNRET

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0046982 protein heterodimerization activity

Cellular Component

GO:0071821 FANCM-MHF complex