Protein

MCA_04825_2

Length
181 amino acids

Gene name: ARF2

Description: ADP-ribosylation factor

Browser: contigC:4180382-4180928+

RNA-seq: read pairs 33387, FPKM 2266.7, percentile rank 97.9% (100% = highest expression)

Protein function

Annotation:ARF2ADP-ribosylation factor
KEGG:K07937ARF1 ADP-ribosylation factor 1
EGGNOG:0PGWRARFadp-ribosylation factor
SGD closest match:S000002296ARF2ADP-ribosylation factor 2
CGD closest match:CAL0000178804ARF2Arf family GTPase

Protein alignments

%idAln lengthE-value
MIA_03721_198.34%1814e-131MIA_03721_1
A0A0J9XDY6_GEOCN97.22%1804e-129Similar to Saccharomyces cerevisiae YDL137W ARF2 ADP-ribosylation factor OS=Geotrichum candidum GN=BN980_GECA09s04113g PE=3 SV=1
A0A060T7Q4_BLAAD95.00%1805e-127ARAD1C29392p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C29392g PE=3 SV=1
A0A167DBV5_9ASCO94.44%1802e-126Arf family GTPase ARF2 OS=Sugiyamaella lignohabitans GN=ARF2 PE=3 SV=1
A0A1E4TKS6_9ASCO90.00%1807e-122Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_22453 PE=3 SV=1
UniRef50_P3657990.00%1807e-118ADP-ribosylation factor 1 n=74 Tax=Eukaryota TaxID=2759 RepID=ARF1_SCHPO
A0A1E3PK85_9ASCO88.89%1803e-120ARF/SAR superfamily OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82725 PE=3 SV=1
Q5AND9_CANAL90.45%1784e-119Arf family GTPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARF2 PE=1 SV=1
Q6C369_YARLI86.52%1782e-115YALI0F02167p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F02167g PE=3 SV=1
ARF2_YEAST78.33%1801e-105ADP-ribosylation factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARF2 PE=1 SV=3

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.6443

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 181

Detailed signature matches

  1. Family IPR006689
    Small GTPase superfamily, ARF/SAR type
    1. PF00025 (Arf)
    2. PR00328 (SAR1GTPBP)
  2. Family IPR024156
    Small GTPase superfamily, ARF type
    1. PS51417 (ARF)
  3. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  4. Domain IPR005225
    Small GTP-binding protein domain
    1. TIGR00231
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.40.50...
  2. SM00175 (rab_sub_5)
  3. SM00177 (arf_sub_2)
  4. SM00178 (sar_sub_1)
  5. cd04150 (Arf1_5_like)

Residue annotation

  1. G1 box cd04150
  2. putative GAP inter...
  3. GTP/Mg2+ binding s...
  4. Switch I region cd...
  5. G2 box cd04150
  6. GEF interaction si...
  7. effector interacti...
  8. interswitch region...
  9. G3 box cd04150
  10. Switch II region c...
  11. G4 box cd04150
  12. G5 box cd04150

Protein sequence

>MCA_04825_2
MGLSISKLLQGLFGRKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRH
YFQNTQGVIFVVDSNDRDRINEAAEELQRIVNEDELHDALILVFANKQDLPNAMNAAEITEKLGLHSLRQRSWYIQATCA
TSGDGLYEGLEWLSTNLKKRG

GO term prediction

Biological Process

GO:0007264 small GTPase mediated signal transduction

Molecular Function

GO:0005525 GTP binding

Cellular Component

GO:0005622 intracellular