Protein

MCA_04775_1

Length
308 amino acids


Gene name: SEC65

Description: Signal recognition particle SEC65 subunit

Browser: contigC:3997061-3997988+

RNA-seq: read pairs 1890, FPKM 75.6, percentile rank 74.2% (100% = highest expression)

Protein function

Annotation:SEC65Signal recognition particle SEC65 subunit
KEGG:K03105SRP19 signal recognition particle subunit SRP19
EGGNOG:0PNRPSEC65Signal recognition particle
SGD closest match:S000004573SEC65Signal recognition particle subunit SEC65
CGD closest match:CAL0000193644SEC65RNA-binding signal recognition particle subunit

Protein alignments

%idAln lengthE-value
MIA_00475_144.75%3243e-88MIA_00475_1
A0A161HJF6_9ASCO42.13%2163e-48Sec65p OS=Sugiyamaella lignohabitans GN=SEC65 PE=4 SV=1
UniRef50_A0A161HJF642.13%2168e-45Sec65p n=2 Tax=Trichomonascaceae TaxID=410830 RepID=A0A161HJF6_9ASCO
A0A0J9XBZ5_GEOCN43.46%1914e-47Similar to Saccharomyces cerevisiae YML105C SEC65 Subunit of the signal recognition particle (SRP) OS=Geotrichum candidum GN=BN980_GECA09s03453g PE=4 SV=1
A0A060T7X6_BLAAD43.30%1942e-46ARAD1D02882p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D02882g PE=4 SV=1
SEC65_YARLI33.80%2842e-37Signal recognition particle SEC65 subunit OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC65 PE=3 SV=1
Q5A9A9_CANAL39.16%1661e-28RNA-binding signal recognition particle subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC65 PE=4 SV=1
SEC65_YEAST35.38%1951e-28Signal recognition particle subunit SEC65 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC65 PE=1 SV=1
A0A1E3PN15_9ASCO31.71%2053e-24Signal recognition particle, SRP19 subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46186 PE=4 SV=1
A0A1E4TJY2_9ASCO32.55%2122e-24Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_665 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0145

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. PF01922 (SRP19)
    2. SSF69695 (SRP19)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_04775_1
MPIIEEISEDELEFDESDFDGAIPFAKGAGDDDGLGPAKLIPKTEAKQPEPKKTIPTQSPLASFDSQPNLFPRQAPGASG
SSLQNNYIEDMEQFKDWNIIYPIYFNKDRSHSEGRKVPTDLAVSNPMVTTIMAALKSFKVPMILEPEKTHPKDWAHPGRI
RYLIHEPELDSYREAEGLKKIETKRQLYKLIGEYLVAHPTTTETPKENPLYRGIRQALIEQQQQLPEQNRISPGQVKVPY
GPKEFPKGWKDKKVGSILPPHSPALPFGEMSESLMESLTKNMFGGLPGMAPGAAAPAPQKPKKIFIRK

GO term prediction

Biological Process

GO:0006614 SRP-dependent cotranslational protein targeting to membrane

Molecular Function

GO:0008312 7S RNA binding

Cellular Component

GO:0048500 signal recognition particle