Protein
MCA_04775_1
Length
308 amino acids
Gene name: SEC65
Description: Signal recognition particle SEC65 subunit
Browser: contigC:3997061-3997988+
RNA-seq: read pairs 1890, FPKM 75.6, percentile rank 74.2% (100% = highest expression)
Protein function
| Annotation: | SEC65 | Signal recognition particle SEC65 subunit | |
|---|---|---|---|
| KEGG: | K03105 | SRP19 | signal recognition particle subunit SRP19 |
| EGGNOG: | 0PNRP | SEC65 | Signal recognition particle |
| SGD closest match: | S000004573 | SEC65 | Signal recognition particle subunit SEC65 |
| CGD closest match: | CAL0000193644 | SEC65 | RNA-binding signal recognition particle subunit |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_00475_1 | 44.75% | 324 | 3e-88 | MIA_00475_1 |
| A0A161HJF6_9ASCO | 42.13% | 216 | 3e-48 | Sec65p OS=Sugiyamaella lignohabitans GN=SEC65 PE=4 SV=1 |
| UniRef50_A0A161HJF6 | 42.13% | 216 | 8e-45 | Sec65p n=2 Tax=Trichomonascaceae TaxID=410830 RepID=A0A161HJF6_9ASCO |
| A0A0J9XBZ5_GEOCN | 43.46% | 191 | 4e-47 | Similar to Saccharomyces cerevisiae YML105C SEC65 Subunit of the signal recognition particle (SRP) OS=Geotrichum candidum GN=BN980_GECA09s03453g PE=4 SV=1 |
| A0A060T7X6_BLAAD | 43.30% | 194 | 2e-46 | ARAD1D02882p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D02882g PE=4 SV=1 |
| SEC65_YARLI | 33.80% | 284 | 2e-37 | Signal recognition particle SEC65 subunit OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC65 PE=3 SV=1 |
| Q5A9A9_CANAL | 39.16% | 166 | 1e-28 | RNA-binding signal recognition particle subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC65 PE=4 SV=1 |
| SEC65_YEAST | 35.38% | 195 | 1e-28 | Signal recognition particle subunit SEC65 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC65 PE=1 SV=1 |
| A0A1E3PN15_9ASCO | 31.71% | 205 | 3e-24 | Signal recognition particle, SRP19 subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46186 PE=4 SV=1 |
| A0A1E4TJY2_9ASCO | 32.55% | 212 | 2e-24 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_665 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0145
Protein family membership
- Signal recognition particle, SRP19 subunit (IPR002778)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MCA_04775_1 MPIIEEISEDELEFDESDFDGAIPFAKGAGDDDGLGPAKLIPKTEAKQPEPKKTIPTQSPLASFDSQPNLFPRQAPGASG SSLQNNYIEDMEQFKDWNIIYPIYFNKDRSHSEGRKVPTDLAVSNPMVTTIMAALKSFKVPMILEPEKTHPKDWAHPGRI RYLIHEPELDSYREAEGLKKIETKRQLYKLIGEYLVAHPTTTETPKENPLYRGIRQALIEQQQQLPEQNRISPGQVKVPY GPKEFPKGWKDKKVGSILPPHSPALPFGEMSESLMESLTKNMFGGLPGMAPGAAAPAPQKPKKIFIRK
GO term prediction
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
Molecular Function
GO:0008312 7S RNA binding
Cellular Component
GO:0048500 signal recognition particle