Protein
MCA_04764_1
Length
289 amino acids
Gene name: ATO2
Description: Putative ammonium permease (export)
Browser: contigC:3974713-3975583+
RNA-seq: read pairs 14, FPKM 0.6, percentile rank 7.4% (100% = highest expression)
Protein function
| Annotation: | ATO2 | Putative ammonium permease (export) | |
|---|---|---|---|
| KEGG: | K07034 | uncharacterized protein | |
| EGGNOG: | 0PGY4 | FG09374.1 | GPR FUN34 family protein |
| SGD closest match: | S000005285 | ATO2 | Ammonia transport outward protein 2 |
| CGD closest match: | CAL0000177981 | FRP3 | Putative ammonium permease |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_03707_1 | 56.27% | 279 | 1e-104 | MIA_03707_1 |
| A0A0J9XI99_GEOCN | 43.17% | 271 | 2e-71 | Similar to Saccharomyces cerevisiae YNR002C ATO2 Putative transmembrane protein involved in export of ammonia OS=Geotrichum candidum GN=BN980_GECA18s01352g PE=4 SV=1 |
| UniRef50_A0A0J9XI99 | 43.17% | 271 | 4e-68 | Similar to Saccharomyces cerevisiae YNR002C ATO2 Putative transmembrane protein involved in export of ammonia n=2 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XI99_GEOCN |
| A0A1E3PPP5_9ASCO | 37.35% | 257 | 1e-46 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49823 PE=4 SV=1 |
| A0A161HWU2_9ASCO | 37.36% | 273 | 2e-44 | Putative ammonium permease ATO2 OS=Sugiyamaella lignohabitans GN=ATO2 PE=4 SV=1 |
| ATO2_YEAST | 30.94% | 278 | 9e-41 | Ammonia transport outward protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATO2 PE=1 SV=1 |
| A0A1D8PHP8_CANAL | 33.10% | 281 | 2e-39 | Putative ammonium permease OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FRP3 PE=4 SV=1 |
| GPR1_YARLI | 34.81% | 270 | 2e-38 | Glyoxylate pathway regulator OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GPR1 PE=1 SV=3 |
| A0A060SVZ0_BLAAD | 28.62% | 290 | 2e-25 | ARAD1A01188p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A01188g PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0380
Protein family membership
- Acetate transporter GPR1/FUN34/SatP family (IPR000791)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF01184 (Grp1_Fun34...)
-
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
-
mobidb-lite (disord...)
Protein sequence
>MCA_04764_1 MASSNKSDEIKTTVSTEEYHISPHPNHDFVMNSHGISRVMTSDTHVHMGGMTFEKQEFLRAFEGALNPGLTVKKYNFGSP APLAISAYCLTMFLFSLVNCGARGVSNSKALVGLTLFYAGFIELIGGFWCLLFENAWGGTMTTAFAAFWFSYGMVLIDAW GCVSSYANNMEEFYNIMGFFLLAWAIFAFIMFSLTFRSTWVLFLMILFIALNLTVLAAAQFCMAGGHTKSGTNLTKAGGV LGILASILGWYSVYEGLATKENSVFVPPVLLMPTAVIPGATKKSDESKS
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
GO:0016021 integral component of membrane