Protein
MCA_04738_1
Length
217 amino acids
Browser: contigC:3878641-3879403+
RNA-seq: read pairs 415, FPKM 23.5, percentile rank 45.9% (100% = highest expression)
Protein function
| EGGNOG: | 0PPP4 | Essential protein Yae1, N terminal | |
|---|---|---|---|
| SGD closest match: | S000005204 | YNL260C | Uncharacterized ORAOV1 family protein YNL260C |
| CGD closest match: | CAL0000201914 | CAALFM_CR06980WA | Ribosome biosynthesis protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_03767_1 | 39.37% | 221 | 7e-46 | MIA_03767_1 |
| A0A0J9X591_GEOCN | 40.00% | 215 | 2e-34 | Similar to Saccharomyces cerevisiae YNL260C LTO1 Essential protein that forms a complex with Rli1p and Yae1p OS=Geotrichum candidum GN=BN980_GECA02s08821g PE=4 SV=1 |
| UniRef50_A0A0J9X591 | 40.00% | 215 | 3e-31 | Similar to Saccharomyces cerevisiae YNL260C LTO1 Essential protein that forms a complex with Rli1p and Yae1p n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X591_GEOCN |
| A0A060TFH5_BLAAD | 39.13% | 138 | 2e-26 | ARAD1D23452p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D23452g PE=4 SV=1 |
| A0A1E3PI67_9ASCO | 35.00% | 120 | 2e-18 | DUF1715-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83184 PE=4 SV=1 |
| Q6C4J8_YARLI | 47.62% | 63 | 1e-16 | YALI0E26169p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E26169g PE=4 SV=1 |
| A0A1D8PTD6_CANAL | 32.77% | 119 | 1e-11 | Ribosome biosynthesis protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR06980WA PE=4 SV=1 |
| YN00_YEAST | 31.15% | 122 | 9e-10 | Uncharacterized ORAOV1 family protein YNL260C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL260C PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0266
Protein family membership
None predicted.
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_04738_1 MDDDIFESSLNLEQQYFDEGFEEGQIAGKIAGIHEGAEFGIQTAFQRYIAIGVLLGRIEVWKRQIEAYKKQASSMDSNDD NEKKNLEKFITKASTSVASLEKMLSPSSIPMTNSDEDVAKLEVLIRKAKSKAKIISNLMKDSSSSSSGNDGASLETKNCS CRQGAETSSNKCCSTKDNKKEEDAGDSDDLSAPIEYHDGRISQMLRPLDEVIEDFRI
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.