Protein
MCA_04728_1
Length
166 amino acids
Gene name: SDH5
Description: Succinate dehydrogenase assembly factor 2, mitochondrial
Browser: contigC:3836422-3836923+
RNA-seq: read pairs 2249, FPKM 166.4, percentile rank 86.0% (100% = highest expression)
Protein function
| Annotation: | SDH5 | Succinate dehydrogenase assembly factor 2, mitochondrial | |
|---|---|---|---|
| KEGG: | K18168 | SDHAF2 | succinate dehydrogenase assembly factor 2 |
| EGGNOG: | 0PPQH | EMI5 | Required for insertion of FAD cofactor into sdh1, the catalytic subunit of succinate dehydrogenase (SDH). SDH is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). In is unclear whether it participates in the chemistry of FAD attachment (enzymatic function) or acts as a chaperone that maintains sdh1 in a conformation that is susceptible to autocatalytic FAD attachment |
| SGD closest match: | S000005432 | SDH5 | Succinate dehydrogenase assembly factor 2, mitochondrial |
| CGD closest match: | CAL0000186694 | orf19.4727 | Succinate dehydrogenase assembly factor 2, mitochondrial |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_03764_1 | 73.04% | 115 | 2e-50 | MIA_03764_1 |
| A0A167DD20_9ASCO | 55.69% | 167 | 2e-48 | Succinate dehydrogenase assembly factor 2, mitochondrial OS=Sugiyamaella lignohabitans GN=EMI5 PE=3 SV=1 |
| A0A0J9XII5_GEOCN | 56.46% | 147 | 2e-46 | Succinate dehydrogenase assembly factor 2, mitochondrial OS=Geotrichum candidum GN=BN980_GECA21s00043g PE=3 SV=1 |
| A0A060SXX8_BLAAD | 54.72% | 159 | 3e-44 | Succinate dehydrogenase assembly factor 2, mitochondrial OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A15994g PE=3 SV=1 |
| SDHF2_YARLI | 66.07% | 112 | 9e-42 | Succinate dehydrogenase assembly factor 2, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0F11957g PE=3 SV=1 |
| UniRef50_Q6C202 | 66.07% | 112 | 2e-38 | Succinate dehydrogenase assembly factor 2, mitochondrial n=20 Tax=Saccharomycetales TaxID=4892 RepID=SDHF2_YARLI |
| A0A1E3PEB9_9ASCO | 48.48% | 165 | 3e-41 | Succinate dehydrogenase assembly factor 2, mitochondrial OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84357 PE=3 SV=1 |
| A0A1D8PEE2_CANAL | 57.02% | 114 | 1e-31 | Succinate dehydrogenase assembly factor 2, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.4727 PE=3 SV=1 |
| SDHF2_YEAST | 45.81% | 155 | 7e-31 | Succinate dehydrogenase assembly factor 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDH5 PE=1 SV=1 |
| A0A1E4TED2_9ASCO | 52.78% | 108 | 1e-27 | Succinate dehydrogenase assembly factor 2, mitochondrial OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_99889 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9788
Predicted cleavage: 37
Protein family membership
- Flavinator of succinate dehydrogenase (IPR005631)
Domains and repeats
None predicted.
Detailed signature matches
-
-
MF_03057 (SDHAF2)
-
no IPR
Unintegrated signatures
Protein sequence
>MCA_04728_1 MLSRQLISRASLATARATIINRSNTCIATSSTIRYYSSKSHNLKTVSQDEKNTKFEFKIEPLPRVGESIEKKRARLLYQS RKRGILECDLLMSTFAKLYLKEMALDELEEYDKLLDENDWDIYYWATNNNDVRPCPERWEKSPILAKLRDMVKTRGHECT RMPDLY
GO term prediction
Biological Process
GO:0018293 protein-FAD linkage
Molecular Function
None predicted.
Cellular Component
GO:0005739 mitochondrion