Protein

MCA_04720_1

Length
268 amino acids

Gene name: MRPL11

Description: 54S ribosomal protein L11, mitochondrial

Browser: contigC:3811283-3812090-

RNA-seq: read pairs 2521, FPKM 115.8, percentile rank 81.2% (100% = highest expression)

Protein function

Annotation:MRPL1154S ribosomal protein L11, mitochondrial
KEGG:K02864RP-L10 large subunit ribosomal protein L10
EGGNOG:0PJ19PGUG_00827mitochondrial 54S ribosomal protein YmL11
SGD closest match:S000002361MRPL1154S ribosomal protein L11, mitochondrial
CGD closest match:CAL0000184844orf19.3797Mitochondrial 54S ribosomal protein YmL11

Protein alignments

%idAln lengthE-value
MIA_05254_160.09%2287e-82MIA_05254_1
A0A0J9X6E5_GEOCN60.81%2224e-76Similar to Saccharomyces cerevisiae YDL202W MRPL11 Mitochondrial ribosomal protein of the large subunit OS=Geotrichum candidum GN=BN980_GECA03s06115g PE=4 SV=1
UniRef50_A0A0J9X6E560.81%2228e-73Similar to Saccharomyces cerevisiae YDL202W MRPL11 Mitochondrial ribosomal protein of the large subunit n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9X6E5_GEOCN
A0A060TDN0_BLAAD51.47%2043e-57ARAD1D49038p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D49038g PE=4 SV=1
A0A1E3PLP4_9ASCO49.02%2047e-50Mitochondrial ribosomal protein of the large subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82808 PE=4 SV=1
RM11_YEAST42.21%1999e-4154S ribosomal protein L11, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL11 PE=1 SV=2
A0A1E4TM19_9ASCO46.67%1958e-40Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_23315 PE=4 SV=1
Q5A693_CANAL38.53%2311e-38Mitochondrial 54S ribosomal protein YmL11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3797 PE=4 SV=1
A0A167EHU7_9ASCO46.37%1793e-39Mitochondrial 54S ribosomal protein YmL11 OS=Sugiyamaella lignohabitans GN=MRPL11 PE=4 SV=1
Q6CCB8_YARLI40.61%1976e-33YALI0C10802p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C10802g PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9941
Predicted cleavage: 58

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR001790
    Ribosomal protein L10P
    1. PF00466 (Ribosomal_L10)
Unintegrated signatures no IPR
Unintegrated signatures
  1. NON_CYTOPLASM... (N...)
  2. PD968187
  3. SIGNAL_PEPTIDE (Sig...)
  4. SIGNAL_PEPTID... (S...)
  5. SIGNAL_PEPTID... (S...)
  6. SIGNAL_PEPTID... (S...)
  7. SSF160369 (Ribosoma...)
  8. cd05797 (Ribosomal_L10)
  9. mobidb-lite (disord...)

Residue annotation

  1. 23S rRNA interface...
  2. Interface with L7/...

Protein sequence

>MCA_04720_1
MLSRYSTRLLLSKRIASSIVAATRTAAIPAASYARLQFMSTASIEQQPAANPVPVRNTVKPIDSRKTTLIDIYSHTLKTS
PVILILHHNNLLSAEDQQLRAQIKKAGGELQVIRPRLFKVALRGQHHEDPASKEAAKLFRNKKSDVFPLLSGPTAIVSFK
ELDPKAVAGVVRIVDKSSGSLALMGAIIDEKVQSIADVAVFKTLPTLAEVRSQLVGVLTVVGGAGLVQTLEASSKVLYLT
MEERRKQLDPAEQAKNEDENGSSEEKKE

GO term prediction

Biological Process

GO:0042254 ribosome biogenesis

Molecular Function

None predicted.

Cellular Component

GO:0005622 intracellular