Protein
MCA_04708_1
Length
233 amino acids
Gene name: YAF9
Description: Protein AF-9 homolog; subunit of NuA4 histone H4 acetyltransferase and SWR1 complexes
Browser: contigC:3777258-3778033+
RNA-seq: read pairs 489, FPKM 25.8, percentile rank 48.5% (100% = highest expression)
Protein function
| Annotation: | YAF9 | Protein AF-9 homolog; subunit of NuA4 histone H4 acetyltransferase and SWR1 complexes | |
|---|---|---|---|
| KEGG: | K11341 | YEATS4 | YEATS domain-containing protein 4 |
| EGGNOG: | 0PGXN | YAF9 | Component of the SWR1 complex which mediates the ATP- dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histones H4 and H2A. The NuA4 complex is also involved in DNA repair. Yaf9 may also be required for viability in conditions in which the structural integrity of the spindle is compromised |
| SGD closest match: | S000005051 | YAF9 | Protein AF-9 homolog |
| CGD closest match: | CAL0000173992 | YAF9 | Protein AF-9 homolog |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_02049_1 | 70.13% | 231 | 4e-110 | MIA_02049_1 |
| A0A0J9XKC7_GEOCN | 66.38% | 232 | 8e-106 | Similar to Saccharomyces cerevisiae YNL107W YAF9 Subunit of both the NuA4 histone H4 acetyltransferase complex and the SWR1 complex OS=Geotrichum candidum GN=BN980_GECA26s00758g PE=4 SV=1 |
| A0A060TBJ5_BLAAD | 54.69% | 245 | 2e-80 | ARAD1B08316p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B08316g PE=4 SV=1 |
| UniRef50_K0K8B6 | 53.81% | 223 | 2e-71 | Uncharacterized protein n=15 Tax=Saccharomycetales TaxID=4892 RepID=K0K8B6_WICCF |
| A0A1E3PKA2_9ASCO | 54.09% | 220 | 3e-72 | YNL107Wp-like protein (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_12887 PE=4 SV=1 |
| A0A1E4TKK3_9ASCO | 49.55% | 222 | 1e-69 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_870 PE=4 SV=1 |
| AF9_YEAST | 47.98% | 223 | 3e-69 | Protein AF-9 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAF9 PE=1 SV=1 |
| AF9_YARLI | 57.39% | 176 | 2e-58 | Protein AF-9 homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YAF9 PE=3 SV=1 |
| AF9_CANAL | 39.43% | 246 | 6e-43 | Protein AF-9 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YAF9 PE=3 SV=1 |
| A0A161HX22_9ASCO | 57.32% | 82 | 4e-27 | Yaf9p OS=Sugiyamaella lignohabitans GN=YAF9 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9202
Protein family membership
- YEATS (IPR005033)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
Protein sequence
>MCA_04708_1 MAPSQRRVKNISISRPFLYGNTAEPLGNNKTPEMPVDHTHKWTIFVRDPNGQDLSKFIKRVVFKLHDTYPNPSRSIEQEP FEVTETGWGEFEITIKIFFVPEANEKPIMLYHHLKLHPYGVPYGPGGGNSASGGNNQPSNTPQNVESFVYDELVFNEPTE PMFQLLTEKPGALMSPKRTKTSPYSLQTEMEEMDRLTSALDKVYHQVKKMQEHIQQLEREKAAIEGGTATVAS
GO term prediction
Biological Process
GO:0006355 regulation of transcription, DNA-templated
Molecular Function
None predicted.
Cellular Component
None predicted.