Protein
MCA_04506_1
Length
270 amino acids
Gene name: ISA1
Description: Iron-sulfur assembly protein 1; Protein required for maturation of mitochondrial [4Fe-4S]
Browser: contigC:3208155-3208968-
RNA-seq: read pairs 5826, FPKM 265.6, percentile rank 91.0% (100% = highest expression)
Protein function
| Annotation: | ISA1 | Iron-sulfur assembly protein 1; Protein required for maturation of mitochondrial [4Fe-4S] | |
|---|---|---|---|
| KEGG: | K13628 | iscA | iron-sulfur cluster assembly protein |
| EGGNOG: | 0PMYF | ISA1 | assembly protein |
| SGD closest match: | S000003950 | ISA1 | Iron-sulfur assembly protein 1 |
| CGD closest match: | CAL0000189095 | ISA1 | Fe-binding Fe/S cluster assembly protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_01097_1 | 61.37% | 277 | 1e-87 | MIA_01097_1 |
| A0A0J9X4A4_GEOCN | 47.35% | 283 | 9e-74 | Similar to Saccharomyces cerevisiae YLL027W ISA1 Mitochondrial matrix protein involved in biogenesis of the iron-sulfur (Fe/S) cluster of Fe/S proteins OS=Geotrichum candidum GN=BN980_GECA02s03728g PE=4 SV=1 |
| A0A060SYW8_BLAAD | 89.22% | 102 | 1e-67 | ARAD1A14674p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A14674g PE=4 SV=1 |
| A0A167E3D1_9ASCO | 84.31% | 102 | 6e-64 | Isa1p OS=Sugiyamaella lignohabitans GN=ISA1 PE=4 SV=1 |
| UniRef50_A0A167E3D1 | 84.31% | 102 | 2e-60 | Isa1p n=4 Tax=Saccharomycetales TaxID=4892 RepID=A0A167E3D1_9ASCO |
| Q6C5C6_YARLI | 83.33% | 102 | 5e-63 | YALI0E19206p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E19206g PE=4 SV=1 |
| A0A1E3PL30_9ASCO | 82.35% | 102 | 2e-60 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82913 PE=4 SV=1 |
| Q5AC29_CANAL | 80.39% | 102 | 8e-60 | Fe-binding Fe/S cluster assembly protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ISA1 PE=4 SV=1 |
| ISA1_YEAST | 76.47% | 102 | 1e-55 | Iron-sulfur assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISA1 PE=1 SV=1 |
| A0A1E4TIM9_9ASCO | 75.49% | 102 | 4e-53 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_29994 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9806
Protein family membership
- FeS cluster insertion protein (IPR016092)
Domains and repeats
-
Domain
1
50
100
150
200
270
Detailed signature matches
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MCA_04506_1 MRQSQVALSITRSSKRFLQTIQQQPASVVTPLVYASGNNSQSSSSSISGKQFSAGQSEQQKWTTYSLPRLSKSSKPFTTP SPPPKKITASVPFKLTTSSKPLNSKATSTTPSKTETPAQPTTLKTETPSINKTSEIASTTTATPSSNTAPAPTKKPRRKI KARKAAITLSPAAVSHLRQLLDQPNPQMIRIGVRNRGCSGLTYHLEYVNEPGKFDEEVVQDGVKVLIDSKALFSIIGSEM DWIDDKLSTRFVFHNPNSKGECGCGESFMV
GO term prediction
Biological Process
GO:0097428 protein maturation by iron-sulfur cluster transfer
Molecular Function
GO:0005198 structural molecule activity
GO:0051536 iron-sulfur cluster binding
Cellular Component
None predicted.