Protein
MCA_04504_1
Length
189 amino acids
Gene name: YFH1
Description: Mitochondrial chaperone Frataxin
Browser: contigC:3202640-3203210-
RNA-seq: read pairs 1015, FPKM 66.0, percentile rank 71.2% (100% = highest expression)
Protein function
| Annotation: | YFH1 | Mitochondrial chaperone Frataxin | |
|---|---|---|---|
| KEGG: | K19054 | FXN | frataxin [EC:1.16.3.1] |
| EGGNOG: | 0PRTK | FRR4 | Mitochondrial chaperone Frataxin |
| SGD closest match: | S000002278 | YFH1 | Frataxin homolog, mitochondrial |
| CGD closest match: | CAL0000188672 | YFH1 | Ferroxidase |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_01099_1 | 78.45% | 116 | 2e-61 | MIA_01099_1 |
| A0A060T4R1_BLAAD | 57.45% | 141 | 4e-49 | ARAD1A19734p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A19734g PE=4 SV=1 |
| UniRef50_A0A060T4R1 | 57.45% | 141 | 9e-46 | ARAD1A19734p n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060T4R1_BLAAD |
| A0A0J9X3E6_GEOCN | 64.91% | 114 | 2e-47 | Similar to Saccharomyces cerevisiae YDL120W YFH1 Mitochondrial matrix iron chaperone, oxidizes and stores iron OS=Geotrichum candidum GN=BN980_GECA02s03761g PE=4 SV=1 |
| Q59PA3_CANAL | 47.13% | 157 | 2e-39 | Ferroxidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YFH1 PE=3 SV=1 |
| A0A1E3PKS5_9ASCO | 60.58% | 104 | 5e-40 | Frataxin (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_6132 PE=4 SV=1 |
| Q6C5T7_YARLI | 52.89% | 121 | 2e-36 | YALI0E15268p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E15268g PE=4 SV=1 |
| A0A1E4TJZ8_9ASCO | 54.08% | 98 | 7e-35 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_15315 PE=3 SV=1 |
| FRDA_YEAST | 49.53% | 107 | 3e-33 | Frataxin homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFH1 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9998
Predicted cleavage: 62
Protein family membership
- Frataxin/CyaY (IPR002908)
- Frataxin (IPR017789)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PS01344 (FRATAXIN_1)
-
Protein sequence
>MCA_04504_1 MSRLASFVSRNSPRILRSINAPSRSALTPFIISQRQLHQTSCLKTQLLPKQITSIHALRHYSTDNTNNSVPDHIDEVSID EFHKVSDESLETVLATYEDLAEVIPDLDVELAQGVLTLDLPGIGSYVINKQPPNKQIWWSSPISGPKRFDLVDGVWTSLR DGSTLKQSLEEETKIVTEERNLPEVTFEI
GO term prediction
Biological Process
GO:0016226 iron-sulfur cluster assembly
GO:0055114 oxidation-reduction process
Molecular Function
GO:0004322 ferroxidase activity
GO:0008199 ferric iron binding
Cellular Component
GO:0005739 mitochondrion