Protein

MCA_04495_2

Length
245 amino acids

Gene name: RPS6

Description: 40S ribosomal protein S6

Browser: contigC:3181253-3182435-

RNA-seq: read pairs 64077, FPKM 3218.5, percentile rank 98.6% (100% = highest expression)

Protein function

Annotation:RPS640S ribosomal protein S6
KEGG:K02991RP-S6e small subunit ribosomal protein S6e
EGGNOG:0PHTTRPS640S ribosomal protein S6
SGD closest match:S000006011RPS6A40S ribosomal protein S6-A
CGD closest match:CAL0000181351RPS6A40S ribosomal protein S6

Protein alignments

%idAln lengthE-value
MIA_01108_185.78%2112e-136MIA_01108_1
A0A060T8T5_BLAAD80.66%2125e-12540S ribosomal protein S6 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D13816g PE=3 SV=1
A0A0F7RSP7_GEOCN79.72%2121e-12540S ribosomal protein S6 OS=Geotrichum candidum GN=BN980_GECA12s02969g PE=3 SV=1
A0A1D8PL99_CANAL78.30%2125e-12340S ribosomal protein S6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS6A PE=3 SV=1
UniRef50_A0A1E4RX9976.67%2102e-108Uncharacterized protein n=1 Tax=Cyberlindnera jadinii NRRL Y-1542 TaxID=983966 RepID=A0A1E4RX99_CYBJA
A0A1E3PFC0_9ASCO78.33%2031e-11640S ribosomal protein S6 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_71647 PE=3 SV=1
RS6_YARLI75.59%2133e-11640S ribosomal protein S6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RPS6 PE=3 SV=1
A0A1E4TA53_9ASCO83.87%1861e-114Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_29481 PE=4 SV=1
RS6A_YEAST74.47%1881e-10440S ribosomal protein S6-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS6A PE=1 SV=1
A0A161HKL0_9ASCO79.01%1818e-9740S ribosomal protein S6 OS=Sugiyamaella lignohabitans GN=RPS6A PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0121

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR001377
    Ribosomal protein S6e
    1. PF01092 (Ribosomal_S6e)
    2. SM01405 (Ribosomal_...)
  2. Family IPR014401
    Ribosomal protein S6, eukaryotic
    1. PIRSF002129 (RPS6e)
  3. SITE IPR018282
    Ribosomal protein S6e, conserved site
    1. PS00578 (RIBOSOMAL_S6E)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. mobidb-lite (disord...)

Protein sequence

>MCA_04495_2
MKLNIAFPANGTQKLIDIDDEHRVRVFYDKRMGQEVEGDSIGDEFKGYIFKITGGNDKQGFPMKQGVLHPTRVRLLLSKG
HSCYRPRRTGERKRKSVRGCIAGPDLAVISLVVVKQGDAEIEGLTDTQVPKRLGPKRASNIRKFFNLTPEDDVRKYVIRR
EIVKNGKTYTKAPKIQRLVTPRTLAHKKAIEDKKRARRQASKDAAKEYQQLVAKRKAERAAELAEAKKRRASSLKAAKAA
ASASA

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome