Protein

MCA_04485_1

Length
88 amino acids

Gene name: TIM11

Description: ATP synthase subunit e, mitochondrial

Browser: contigC:3155132-3155589+

RNA-seq: read pairs 7809, FPKM 1084.1, percentile rank 96.7% (100% = highest expression)

Protein function

Annotation:TIM11ATP synthase subunit e, mitochondrial
KEGG:K01549TIM11 F-type H+-transporting ATP synthase subunit e
EGGNOG:0PS6SFG00429.1ATP synthase E chain
SGD closest match:S000007255TIM11ATP synthase subunit e, mitochondrial
CGD closest match:CAL0000181686orf19.5660.1F1F0 ATP synthase subunit e

Protein alignments

%idAln lengthE-value
MIA_01178_176.14%882e-37MIA_01178_1
A0A0J9X5A1_GEOCN71.11%901e-31Similar to Saccharomyces cerevisiae YDR322C-A TIM11 Subunit of mitochondrial F1F0-ATPase OS=Geotrichum candidum GN=BN980_GECA02s03332g PE=4 SV=1
B5FVG3_YARLI55.42%833e-22YALI0E32164p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E32164g PE=4 SV=1
UniRef50_B5FVG355.42%837e-19YALI0E32164p n=3 Tax=Dipodascaceae TaxID=34353 RepID=B5FVG3_YARLI
A0A1E3PG50_9ASCO45.98%873e-14Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83888 PE=4 SV=1
ATPJ_YEAST37.93%874e-13ATP synthase subunit e, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM11 PE=1 SV=2
A0A1D8PL02_CANAL41.57%892e-11F1F0 ATP synthase subunit e OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5660.1 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.6990
Predicted cleavage: 13

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR008386
    ATP synthase, F0 complex, subunit E, mitochondrial
    1. PF05680 (ATP-synt_E)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil

Protein sequence

>MCA_04485_1
MSSAPVLNVFRWGALGAGVVYGFVHNLTLSSQAEEQKAAKEYARKEALIKEAKAKYAELHPKPVSKDGPVNFDDPNFDLE
AYITKALS

GO term prediction

Biological Process

GO:0015986 ATP synthesis coupled proton transport

Molecular Function

GO:0015078 hydrogen ion transmembrane transporter activity

Cellular Component

GO:0000276 mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)