Protein
MCA_04479_1
Length
433 amino acids
Gene name: ARP3
Description: Actin-related protein 3
Browser: contigC:3145614-3147342-
RNA-seq: read pairs 13210, FPKM 376.1, percentile rank 93.2% (100% = highest expression)
Protein function
| Annotation: | ARP3 | Actin-related protein 3 | |
|---|---|---|---|
| KEGG: | K18584 | ACTR3 | actin-related protein 3 |
| EGGNOG: | 0PGM8 | ARP3 | Arp2 3 complex |
| SGD closest match: | S000003826 | ARP3 | Actin-related protein 3 |
| CGD closest match: | CAL0000184019 | ARP3 | Actin-related protein 3 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_05880_1 | 88.22% | 433 | 0.0 | MIA_05880_1 |
| A0A0J9XDV7_GEOCN | 85.06% | 435 | 0.0 | Similar to Saccharomyces cerevisiae YJR065C ARP3 Essential component of the Arp2/3 complex OS=Geotrichum candidum GN=BN980_GECA12s01121g PE=3 SV=1 |
| A0A1E3PR79_9ASCO | 79.09% | 440 | 0.0 | Actin/actin-like protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_69254 PE=3 SV=1 |
| A0A060T676_BLAAD | 77.29% | 436 | 0.0 | ARAD1C11726p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C11726g PE=3 SV=1 |
| Q6C3K0_YARLI | 75.46% | 432 | 0.0 | YALI0E34170p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E34170g PE=3 SV=1 |
| A0A1E4TLB1_9ASCO | 78.83% | 411 | 0.0 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_87833 PE=3 SV=1 |
| Q59Z11_CANAL | 74.58% | 413 | 0.0 | Actin-related protein 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARP3 PE=3 SV=1 |
| ARP3_YEAST | 69.20% | 461 | 0.0 | Actin-related protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP3 PE=1 SV=1 |
| UniRef50_P47117 | 69.20% | 461 | 0.0 | Actin-related protein 3 n=449 Tax=Opisthokonta TaxID=33154 RepID=ARP3_YEAST |
| A0A167FG65_9ASCO | 84.83% | 323 | 1e-180 | Actin-related protein 3 OS=Sugiyamaella lignohabitans GN=ARP3 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.8578
Predicted cleavage: 74
Protein family membership
- Actin family (IPR004000)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PS01132 (ACTINS_ACT...)
-
no IPR
Unintegrated signatures
Residue annotation
-
nucleotide binding...
Protein sequence
>MCA_04479_1 MSFSAAPAVVMAIRTNSSNFFSLIRSGTGLTKLGFAGNDSPSFIFPTVIATRQSVGGTRTQAGAAGGHLSQRRGTEDLDF FIGNEALEAANGPHYGLNYPIRHGQVENWDHMERFWENSIFQYLRCEPEDHHFLLTEPPLNPPENRENTAEIMFESFNCA GLYIAVQAVLALAASWTSGKVVDRTLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITYFIQSLLRDRNEPDSS LKTAERIKEEYCYVSPDIVKEFSRYDMEPERFQKYIVDQGLGRKIQVDVGYERFLAPEIFFNPEIYSSDYLTPLPTVVDS VVQASPIDVRRGLYKNIVLSGGSTMFRDFGRRLQRDIRALVNDRIHRSEQISGAKSGGLDVNVISHKKQRNAVWFGGSLL ASTAEFRNICYTKADYDEYGPNIVRQFSLFNVP
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.