Protein
MCA_04478_1
Length
159 amino acids
Gene name: IMG2
Description: 54S ribosomal protein IMG2, mitochondrial
Browser: contigC:3144874-3145354+
RNA-seq: read pairs 1666, FPKM 128.7, percentile rank 82.8% (100% = highest expression)
Protein function
| Annotation: | IMG2 | 54S ribosomal protein IMG2, mitochondrial | |
|---|---|---|---|
| KEGG: | K17430 | MRPL49 | large subunit ribosomal protein L49 |
| SGD closest match: | S000000667 | IMG2 | 54S ribosomal protein IMG2, mitochondrial |
| CGD closest match: | CAL0000196484 | IMG2 | Mitochondrial 54S ribosomal protein IMG2 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_05879_1 | 53.69% | 149 | 1e-42 | MIA_05879_1 |
| A0A0J9XEJ7_GEOCN | 55.86% | 111 | 4e-39 | Similar to Saccharomyces cerevisiae YCR071C IMG2 Mitochondrial ribosomal protein of the large subunit OS=Geotrichum candidum GN=BN980_GECA12s01110g PE=4 SV=1 |
| UniRef50_A0A0J9XEJ7 | 55.86% | 111 | 8e-36 | Similar to Saccharomyces cerevisiae YCR071C IMG2 Mitochondrial ribosomal protein of the large subunit n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XEJ7_GEOCN |
| A0A167FG84_9ASCO | 42.86% | 112 | 7e-27 | Mitochondrial 54S ribosomal protein IMG2 OS=Sugiyamaella lignohabitans GN=IMG2 PE=4 SV=1 |
| A0A060T0B7_BLAAD | 30.56% | 108 | 6e-13 | ARAD1C11748p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C11748g PE=4 SV=1 |
| Q6CHQ2_YARLI | 34.96% | 123 | 2e-12 | YALI0A06501p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A06501g PE=4 SV=2 |
| A0A1E3PPV1_9ASCO | 33.04% | 115 | 1e-12 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_40609 PE=4 SV=1 |
| A0A1E4TI23_9ASCO | 32.99% | 97 | 5e-12 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_123319 PE=4 SV=1 |
| IMG2_YEAST | 32.73% | 110 | 7e-10 | 54S ribosomal protein IMG2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMG2 PE=1 SV=2 |
| A0A1D8PM86_CANAL | 36.11% | 72 | 2e-06 | Mitochondrial 54S ribosomal protein IMG2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IMG2 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.8862
Predicted cleavage: 24
Protein family membership
- Ribosomal protein L49/IMG2 (IPR007740)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
NON_CYTOPLASM... (N...)
-
SIGNAL_PEPTIDE (Sig...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
Protein sequence
>MCA_04478_1 MLRRSLQLLGSQTRAFSMTCARSNVTTSSSTIEIKPAPKIPEPAKPVELFPSLESITINDLSLQRAQPPATPKKDQAGWY RVTRTKANQLPVYSEVRANGHRSTIIRRIEGSVTLLKSDLMKALELPKESIKIKPTSNQIKIKGDYVYKIRELFTEANF
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome