Protein

MCA_04476_1

Length
253 amino acids


Gene name: EMC3

Description: ER membrane protein complex subunit 3

Browser: contigC:3142631-3143457+

RNA-seq: read pairs 2918, FPKM 141.9, percentile rank 84.2% (100% = highest expression)

Protein function

Annotation:EMC3ER membrane protein complex subunit 3
EGGNOG:0PKADEMC3DUF850 domain protein
SGD closest match:S000001690EMC3ER membrane protein complex subunit 3
CGD closest match:CAL0000176158orf19.6462ER membrane protein complex subunit 3

Protein alignments

%idAln lengthE-value
MIA_05877_174.60%2523e-124MIA_05877_1
A0A0J9XFI8_GEOCN61.85%2491e-105ER membrane protein complex subunit 3 OS=Geotrichum candidum GN=BN980_GECA13s02727g PE=3 SV=1
A0A060T0E3_BLAAD52.71%2582e-91ER membrane protein complex subunit 3 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C12408g PE=3 SV=1
Q6C523_YARLI51.00%2497e-84ER membrane protein complex subunit 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E21670g PE=3 SV=1
UniRef50_Q6C52351.00%2492e-80ER membrane protein complex subunit 3 n=4 Tax=Saccharomycetales TaxID=4892 RepID=Q6C523_YARLI
A0A1E3PHG3_9ASCO47.13%2617e-76ER membrane protein complex subunit 3 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83822 PE=3 SV=1
A0A1D8PR41_CANAL44.44%2613e-64ER membrane protein complex subunit 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6462 PE=3 SV=1
A0A1E4TGV3_9ASCO40.16%2492e-50ER membrane protein complex subunit 3 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_113951 PE=3 SV=1
EMC3_YEAST37.70%2528e-46ER membrane protein complex subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMC3 PE=1 SV=3

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0808

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)

Protein sequence

>MCA_04476_1
MSVPDLVLDPQLRVWVLIPILFVMILFGLLRHYANILIVSKPKIQDINSLREQQFLVFGQNLRTNGINLSDRSFTKIRDY
YSEKMKSGAYLKNPDAPANAPPNFSDPSNMDGLMGMVKAQALNFVPQTIMMSWVNALFSGFLVMKLPFPLTIRFKSMLQS
GVATKDLDVRWVSAVSWYVLNLIGLKSVFSLLLGNDNTAAGAGQTPMAMPNLSQPGVDVGKLFIAEAENLDLTPPESLLN
GIEARIINKYSTL

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

GO:0016020 membrane