Protein

MCA_04444_1

Length
365 amino acids

Gene name: DMC1

Description: Meiotic recombination protein DMC1; RAD51-like protein

Browser: contigC:3067763-3069468+

RNA-seq: read pairs 4, FPKM 0.1, percentile rank 4.0% (100% = highest expression)

Protein function

Annotation:DMC1Meiotic recombination protein DMC1; RAD51-like protein
KEGG:K10872DMC1 meiotic recombination protein DMC1
EGGNOG:0PGDFDMC1meiotic recombination protein (Dmc1)
SGD closest match:S000000981DMC1Meiotic recombination protein DMC1
CGD closest match:CAL0000182507DLH1Recombinase

Protein alignments

%idAln lengthE-value
UniRef50_P5026577.53%3162e-180Meiotic recombination protein DLH1 n=13 Tax=Fungi TaxID=4751 RepID=DLH1_CANAX
DMC1_YEAST75.39%3170.0Meiotic recombination protein DMC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DMC1 PE=1 SV=1
A0A1D8PFE4_CANAL76.90%3160.0Recombinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DLH1 PE=3 SV=1
A0A0J9X7F8_GEOCN73.93%3263e-174Similar to Saccharomyces cerevisiae YER179W DMC1 Meiosis-specific protein required for repair of double-strand breaks and pairing between homologous chromosomes OS=Geotrichum candidum GN=BN980_GECA03s06632g PE=4 SV=1
MIA_03640_182.61%2763e-171MIA_03640_1
Q6C1K4_YARLI46.37%3173e-101YALI0F15477p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F15477g PE=3 SV=1
A0A167CM09_9ASCO47.84%2783e-92Recombinase RAD51 OS=Sugiyamaella lignohabitans GN=RAD51 PE=3 SV=1
A0A060T5A1_BLAAD45.78%3085e-90ARAD1C10362p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C10362g PE=3 SV=1
A0A1E3PNM9_9ASCO37.84%741e-09Rad51 N-terminal domain-like protein (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81649 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0421

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
  3. Domain
1 50 100 150 200 250 300 365

Detailed signature matches

  1. Family IPR016467
    DNA recombination and repair protein, RecA-like
    1. PIRSF005856 (Rad51)
  2. Family IPR011940
    Meiotic recombinase Dmc1
    1. TIGR02238
  3. Domain IPR010995
    DNA repair Rad51/transcription factor NusA, alpha-helical
    1. SSF47794 (Rad51 N-t...)
  4. Domain IPR013632
    DNA recombination and repair protein Rad51-like, C-terminal
    1. PF08423 (Rad51)
  5. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  6. Domain IPR020588
    DNA recombination and repair protein RecA-like, ATP-binding domain
    1. PS50162 (RECA_2)
  7. Domain IPR033925
    Rad51/DMC1/RadA
    1. cd01123 (Rad51_DMC1...)
  8. Domain IPR003593
    AAA+ ATPase domain
    1. SM00382 (AAA_5)
  9. Domain IPR020587
    DNA recombination and repair protein RecA, monomer-monomer interface
    1. PS50163 (RECA_3)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. G3DSA:1.10.15...
  3. G3DSA:3.40.50...
  4. PF14520 (HHH_5)
  5. mobidb-lite (disord...)

Residue annotation

  1. Walker A motif cd0...
  2. ATP binding site c...
  3. multimer (BRC) int...
  4. Walker B motif cd0...

Protein sequence

>MCA_04444_1
MGPKRTATSKNSTTIASDEANTTNTLAMDGSSNSDVGNDSGIDLTLDIIGVDELQNHGINAADIQKLKSAGIHSISTVLS
TTRRNLLKIKGFSEVKVEKIKESANKILNVGFVSGTEQAFLRKRVYTLSTGSKAFDSMLGGGIQTMSLTEVFGEFRCGKT
QLAHTLCVCAQLPKSMGGAEGKVAYIDTEGTFRPERIAKIAERFGVDPDICLENISYARALNSEHQMELIEEIGASFAEG
TYRLLIIDSIMALFRVDFSGRGELNERQQKLNQMLGRLTRLAEEYNVAVFLTNQVQSDPGASALFASADGRKPVGGHVLA
HASATRILLRKGRGEERVAKLQDSPDMPENECTYVISDGGISDVA

GO term prediction

Biological Process

GO:0006259 DNA metabolic process
GO:0006281 DNA repair
GO:0007131 reciprocal meiotic recombination

Molecular Function

GO:0000166 nucleotide binding
GO:0003677 DNA binding
GO:0005524 ATP binding
GO:0008094 DNA-dependent ATPase activity

Cellular Component

GO:0005634 nucleus