MCA_04444_1
Gene name: DMC1
Description: Meiotic recombination protein DMC1; RAD51-like protein
Browser: contigC:3067763-3069468+
RNA-seq: read pairs 4, FPKM 0.1, percentile rank 4.0% (100% = highest expression)
Protein function
Annotation: | DMC1 | Meiotic recombination protein DMC1; RAD51-like protein | |
---|---|---|---|
KEGG: | K10872 | DMC1 | meiotic recombination protein DMC1 |
EGGNOG: | 0PGDF | DMC1 | meiotic recombination protein (Dmc1) |
SGD closest match: | S000000981 | DMC1 | Meiotic recombination protein DMC1 |
CGD closest match: | CAL0000182507 | DLH1 | Recombinase |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
UniRef50_P50265 | 77.53% | 316 | 2e-180 | Meiotic recombination protein DLH1 n=13 Tax=Fungi TaxID=4751 RepID=DLH1_CANAX |
DMC1_YEAST | 75.39% | 317 | 0.0 | Meiotic recombination protein DMC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DMC1 PE=1 SV=1 |
A0A1D8PFE4_CANAL | 76.90% | 316 | 0.0 | Recombinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DLH1 PE=3 SV=1 |
A0A0J9X7F8_GEOCN | 73.93% | 326 | 3e-174 | Similar to Saccharomyces cerevisiae YER179W DMC1 Meiosis-specific protein required for repair of double-strand breaks and pairing between homologous chromosomes OS=Geotrichum candidum GN=BN980_GECA03s06632g PE=4 SV=1 |
MIA_03640_1 | 82.61% | 276 | 3e-171 | MIA_03640_1 |
Q6C1K4_YARLI | 46.37% | 317 | 3e-101 | YALI0F15477p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F15477g PE=3 SV=1 |
A0A167CM09_9ASCO | 47.84% | 278 | 3e-92 | Recombinase RAD51 OS=Sugiyamaella lignohabitans GN=RAD51 PE=3 SV=1 |
A0A060T5A1_BLAAD | 45.78% | 308 | 5e-90 | ARAD1C10362p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C10362g PE=3 SV=1 |
A0A1E3PNM9_9ASCO | 37.84% | 74 | 1e-09 | Rad51 N-terminal domain-like protein (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81649 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0421
Protein family membership
- DNA recombination and repair protein, RecA-like (IPR016467)
- Meiotic recombinase Dmc1 (IPR011940)
Domains and repeats
-
Domain
-
Domain
-
Domain
Detailed signature matches

-
-
-
-
PF14520 (HHH_5)
-
mobidb-lite (disord...)
Residue annotation
-
Walker A motif cd0...
-
ATP binding site c...
-
multimer (BRC) int...
-
Walker B motif cd0...
Protein sequence
>MCA_04444_1 MGPKRTATSKNSTTIASDEANTTNTLAMDGSSNSDVGNDSGIDLTLDIIGVDELQNHGINAADIQKLKSAGIHSISTVLS TTRRNLLKIKGFSEVKVEKIKESANKILNVGFVSGTEQAFLRKRVYTLSTGSKAFDSMLGGGIQTMSLTEVFGEFRCGKT QLAHTLCVCAQLPKSMGGAEGKVAYIDTEGTFRPERIAKIAERFGVDPDICLENISYARALNSEHQMELIEEIGASFAEG TYRLLIIDSIMALFRVDFSGRGELNERQQKLNQMLGRLTRLAEEYNVAVFLTNQVQSDPGASALFASADGRKPVGGHVLA HASATRILLRKGRGEERVAKLQDSPDMPENECTYVISDGGISDVA
GO term prediction
Biological Process
GO:0006259 DNA metabolic process
GO:0006281 DNA repair
GO:0007131 reciprocal meiotic recombination
Molecular Function
GO:0000166 nucleotide binding
GO:0003677 DNA binding
GO:0005524 ATP binding
GO:0008094 DNA-dependent ATPase activity
Cellular Component
GO:0005634 nucleus