Protein
MCA_04437_1
Length
266 amino acids
Gene name: MRPL24
Description: 54S ribosomal protein L24, mitochondrial
Browser: contigC:3049718-3050519+
RNA-seq: read pairs 5112, FPKM 236.6, percentile rank 89.9% (100% = highest expression)
Protein function
| Annotation: | MRPL24 | 54S ribosomal protein L24, mitochondrial | |
|---|---|---|---|
| KEGG: | K02902 | RP-L28 | large subunit ribosomal protein L28 |
| EGGNOG: | 0PJC5 | MRPL24 | mitochondrial 54S ribosomal protein YmL24 YmL14 |
| SGD closest match: | S000004806 | MRPL24 | 54S ribosomal protein L24, mitochondrial |
| CGD closest match: | CAL0000201358 | orf19.828 | Mitochondrial 54S ribosomal protein YmL24/YmL14 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_03650_1 | 63.60% | 250 | 7e-116 | MIA_03650_1 |
| A0A0J9XG87_GEOCN | 59.51% | 247 | 2e-105 | Similar to Saccharomyces cerevisiae YMR193W MRPL24 Mitochondrial ribosomal protein of the large subunit OS=Geotrichum candidum GN=BN980_GECA14s03024g PE=4 SV=1 |
| UniRef50_A0A0J9XG87 | 59.51% | 247 | 4e-102 | Similar to Saccharomyces cerevisiae YMR193W MRPL24 Mitochondrial ribosomal protein of the large subunit n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XG87_GEOCN |
| A0A167EPJ2_9ASCO | 45.88% | 279 | 2e-72 | Mitochondrial 54S ribosomal protein YmL24/YmL14 OS=Sugiyamaella lignohabitans GN=MRPL24 PE=4 SV=1 |
| A0A060TA15_BLAAD | 43.27% | 245 | 2e-60 | ARAD1D23650p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D23650g PE=4 SV=1 |
| RM24_YEAST | 47.87% | 211 | 6e-58 | 54S ribosomal protein L24, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL24 PE=1 SV=2 |
| A0A1E3PE35_9ASCO | 55.03% | 149 | 4e-50 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48000 PE=3 SV=1 |
| Q5AHG8_CANAL | 37.25% | 247 | 7e-40 | Mitochondrial 54S ribosomal protein YmL24/YmL14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.828 PE=4 SV=1 |
| Q6CFD6_YARLI | 45.28% | 159 | 6e-35 | YALI0B08074p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B08074g PE=4 SV=1 |
| A0A1E4TE83_9ASCO | 52.38% | 105 | 6e-32 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_18749 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9256
Predicted cleavage: 146
Protein family membership
- L28p-like (IPR034704)
- Ribosomal protein L28/L24 (IPR026569)
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MCA_04437_1 MISNIFKRNILGSAPSATALTLTQRPFSTTSTRQKLYAHITRRKQKEQIPIVPGLPKKFLPKAAPEFPLYPYGKAQWFKR SDKGLYGGKIIQFGNQISEFRNKSRRSWKPNVAYHSLWSEALNRIIGIKTTARVLRTITKEGGIDRYLTKDKPARIKELG LTGWKLRYRVLKKLEIKEKTAPKVLEYIEKDGQSVPVFFKHTSSNGSELKITVGKRKLMAELFAILKGSESAPSYKTFYS EYVNKPASSIISDLESHNFNFSKVSA
GO term prediction
Biological Process
None predicted.
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
None predicted.