Protein

MCA_04413_1

Length
430 amino acids

Gene name: CAR2

Description: Ornithine aminotransferase

Browser: contigC:2983042-2984335+

RNA-seq: read pairs 17228, FPKM 493.9, percentile rank 94.2% (100% = highest expression)

Protein function

Annotation:CAR2Ornithine aminotransferase
KEGG:K00819rocD ornithine--oxo-acid transaminase [EC:2.6.1.13]
EGGNOG:0PHVBCAR2ornithine aminotransferase
SGD closest match:S000004430CAR2Ornithine aminotransferase
CGD closest match:CAL0000189642CAR2Ornithine-oxo-acid transaminase

Protein alignments

%idAln lengthE-value
MIA_00673_189.49%4280.0MIA_00673_1
A0A0J9XJ27_GEOCN87.09%4260.0Similar to Saccharomyces cerevisiae YLR438W CAR2 L-ornithine transaminase (OTAse) OS=Geotrichum candidum GN=BN980_GECA22s00494g PE=3 SV=1
A0A167CAC2_9ASCO83.88%4280.0Ornithine-oxo-acid transaminase OS=Sugiyamaella lignohabitans GN=CAR2 PE=3 SV=1
A0A060TEU7_BLAAD80.00%4250.0ARAD1D16918p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D16918g PE=3 SV=1
A0A1E3PM73_9ASCO79.39%4270.0Ornithine aminotransferase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45966 PE=3 SV=1
Q6CD21_YARLI74.88%4300.0YALI0C04433p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C04433g PE=3 SV=1
A0A1E4TK98_9ASCO72.37%4270.0Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30391 PE=3 SV=1
A0A1D8PL14_CANAL73.71%4260.0Ornithine-oxo-acid transaminase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAR2 PE=3 SV=1
UniRef50_A0A0H5BYM272.54%4260.0CAR2 protein n=12 Tax=cellular organisms TaxID=131567 RepID=A0A0H5BYM2_CYBJA
OAT_YEAST64.78%4230.0Ornithine aminotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAR2 PE=1 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0258

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 400 430

Detailed signature matches

  1. Family IPR005814
    Aminotransferase class-III
    1. PS00600 (AA_TRANSFE...)
    2. cd00610 (OAT_like)
    3. PIRSF000521 (Transa...)
    4. PF00202 (Aminotran_3)
  2. Family IPR010164
    Ornithine aminotransferase
    1. TIGR01885
  3. Domain IPR015422
    Pyridoxal phosphate-dependent transferase, subdomain 2
    1. G3DSA:3.90.11...
  4. Domain IPR015424
    Pyridoxal phosphate-dependent transferase
    1. SSF53383 (PLP-depen...)
  5. Domain IPR015421
    Pyridoxal phosphate-dependent transferase, major region, subdomain 1
    1. G3DSA:3.40.64...

Residue annotation

  1. inhibitor-cofactor...
  2. pyridoxal 5'-phosp...
  3. catalytic residue ...

Protein sequence

>MCA_04413_1
MSLLANITSATAIEYEEKYSAHNYHPLPVVLSKAKGAHVWDPEGNDYLDFLSAYSAVNQGHCHPKIVAALTEQANKLTLS
SRAFYNDVFGQFAKYVTEYFGYEMVLPMNTGAEAVETAIKLARKWGYMKKGIPQGEAIVLSATENFHGRTIAIVSMSTDP
EAKENYGPYLENVGPFIPGTNKPLRYNNIEDLEEAFNNAGDKIAAFLVEPIQGEAGIVVPAPDYLSKVHALCKKHNVLMI
ADEIQTGIARTGKLLCIEHSNIHPDIVLLGKAISGGVTPVSAVLSSKDIMLCIEPGTHGSTYGGNPLSCAVSMAALQVVK
DENLVERAATLGEKFRKGLEPLLETGIVSEIRGKGLLNAIVIDASKANGRSAWDLCLLMKEKGLLAKPTHDTIIRLAPPL
VISEEDIEKGLKIISEAVKELPNAPKSSDH

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003824 catalytic activity
GO:0004587 ornithine-oxo-acid transaminase activity
GO:0008483 transaminase activity
GO:0030170 pyridoxal phosphate binding

Cellular Component

None predicted.