Protein
MCA_04342_1
Length
99 amino acids
Browser: contigC:2756434-2756825-
RNA-seq: read pairs 388, FPKM 47.9, percentile rank 64.5% (100% = highest expression)
Protein function
SGD closest match: | S000001957 | SAE3 | Pachytene arrest protein SAE3 |
---|---|---|---|
CGD closest match: | CAL0000183398 | orf19.5069 | Uncharacterized protein |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9XA00_GEOCN | 63.46% | 52 | 3e-17 | Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA06s04635g PE=4 SV=1 |
UniRef50_A0A0J9XA00 | 63.46% | 52 | 7e-14 | Uncharacterized protein n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XA00_GEOCN |
MIA_03995_1 | 54.90% | 51 | 7e-13 | MIA_03995_1 |
A0A1E3PEX5_9ASCO | 48.98% | 49 | 1e-11 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47852 PE=4 SV=1 |
A0A1D8PE61_CANAL | 38.46% | 52 | 1e-08 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5069 PE=4 SV=1 |
SAE3_YEAST | 40.43% | 47 | 9e-07 | Pachytene arrest protein SAE3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAE3 PE=1 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0552
Protein family membership
- DNA repair protein, Swi5 (IPR010760)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
Protein sequence
>MCA_04342_1 MFKHRYYQHKAVPQTLEEIEKRIAEKKEKLEGLKKEYEELTKSFQDEDPQTIVNEHIRRLKEYNEIKDVATMLMAKIADQ RGITISEVLSEMKVDLSLS
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.