Protein
MCA_04341_1
Length
135 amino acids
Browser: contigC:2755396-2756145+
RNA-seq: read pairs 1358, FPKM 123.4, percentile rank 82.2% (100% = highest expression)
Protein function
KEGG: | K06875 | PDCD5 | programmed cell death protein 5 |
---|---|---|---|
EGGNOG: | 0PR3P | PGUG_05569 | Programmed cell death protein |
SGD closest match: | S000004678 | YMR074C | Uncharacterized protein YMR074C |
CGD closest match: | CAL0000190178 | CAALFM_CR06530WA | Uncharacterized protein |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_00094_1 | 63.85% | 130 | 7e-43 | MIA_00094_1 |
A0A0J9X2Y8_GEOCN | 58.59% | 128 | 2e-39 | Similar to Saccharomyces cerevisiae YMR074C Protein with homology to human PDCD5, which is involved in programmed cell death OS=Geotrichum candidum GN=BN980_GECA01s07116g PE=4 SV=1 |
A0A1E3PKK3_9ASCO | 59.06% | 127 | 1e-35 | DNA-binding TFAR19-related protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47129 PE=4 SV=1 |
A0A060TDR6_BLAAD | 52.03% | 123 | 6e-31 | ARAD1D09460p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D09460g PE=4 SV=1 |
UniRef50_A3LXT7 | 50.41% | 123 | 7e-25 | Uncharacterized protein n=9 Tax=Saccharomycetales TaxID=4892 RepID=A3LXT7_PICST |
A0A1D8PT84_CANAL | 47.15% | 123 | 7e-27 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR06530WA PE=4 SV=1 |
Q6C042_YARLI | 51.16% | 129 | 2e-25 | YALI0F27951p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F27951g PE=4 SV=1 |
A0A1E4TL79_9ASCO | 50.00% | 72 | 7e-18 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30564 PE=4 SV=1 |
YMW4_YEAST | 35.54% | 121 | 7e-16 | Uncharacterized protein YMR074C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR074C PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0386
Protein family membership
- PDCD5-related protein (IPR002836)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PIRSF015730 (TFAR19)
-
-
PF01984 (dsDNA_bind)
-
SSF46950 (Double-st...)
-

Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_04341_1 MDESELNAIRQARLAELQKKSGSSSGSFPGAPSGPSNASGSQDDDVRLSQLARILTPEARERLSRIRIVRGDRAKNVEDL ILRLARSGQIQQQVTEKDLVQLLEQISEQENKTNRTKIVFERRVQQDDDDDDFFD
GO term prediction
Biological Process
None predicted.
Molecular Function
GO:0003677 DNA binding
Cellular Component
None predicted.