Protein
MCA_04335_1
Length
655 amino acids
Gene name: ARP4A
Description: Actin-related protein 4
Browser: contigC:2735868-2737923+
RNA-seq: read pairs 2097, FPKM 39.5, percentile rank 60.0% (100% = highest expression)
Protein function
Annotation: | ARP4A | Actin-related protein 4 | |
---|---|---|---|
EGGNOG: | 0PFT0 | ARP4 | Chromatin interaction component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. The NuA4 complex is also involved in DNA repair. Is required for NuA4 complex integrity. Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the INO80 complex which remodels chromatin by shifting nucleosomes and is involved in DNA repair (By similarity) |
SGD closest match: | S000003617 | ARP4 | Actin-related protein 4 |
CGD closest match: | CAL0000192300 | ARP4 | Actin-related protein 4 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_04502_1 | 48.05% | 435 | 2e-123 | MIA_04502_1 |
A0A0J9X965_GEOCN | 48.80% | 418 | 7e-114 | Similar to Saccharomyces cerevisiae YJL081C ARP4 Nuclear actin-related protein involved in chromatin remodeling OS=Geotrichum candidum GN=BN980_GECA05s07193g PE=3 SV=1 |
UniRef50_A0A0J9X965 | 48.80% | 418 | 1e-110 | Similar to Saccharomyces cerevisiae YJL081C ARP4 Nuclear actin-related protein involved in chromatin remodeling n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X965_GEOCN |
A0A1E3PF79_9ASCO | 39.12% | 409 | 6e-82 | Actin/actin-like protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84099 PE=3 SV=1 |
A0A060TBR0_BLAAD | 46.29% | 283 | 1e-76 | ARAD1D34012p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D34012g PE=3 SV=1 |
A0A167EZV1_9ASCO | 48.41% | 252 | 2e-71 | Arp4p OS=Sugiyamaella lignohabitans GN=ARP4 PE=3 SV=1 |
ARP4_YARLI | 43.32% | 277 | 3e-70 | Actin-related protein 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ARP4 PE=3 SV=1 |
A0A1E4TII5_9ASCO | 41.98% | 262 | 1e-62 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_147306 PE=3 SV=1 |
ARP4_CANAL | 60.38% | 106 | 2e-36 | Actin-related protein 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARP4 PE=3 SV=3 |
ARP4_YEAST | 50.00% | 120 | 2e-34 | Actin-related protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP4 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0101
Protein family membership
- Actin family (IPR004000)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PS00432 (ACTINS_2)
-

Unintegrated signatures
-
-
SSF53067 (Actin-lik...)
-
cd00012 (NBD_sugar-...)
-
mobidb-lite (disord...)
Residue annotation
-
nucleotide binding...
Protein sequence
>MCA_04335_1 MTSASSAPAVYGGDEVSAVVLDVGSRTTRAGFAGEDSPKAVFSTYYAVQNSDKPSLSPFTKTTKKDTDNTTSDEANTNVD KDGDVNMEDNDTTKDNEEPKTLEDDERVSNSEKKSATEDSATTTSAKEETEKKDDIKLRSANSLKDYKKYFIGDNSIHIP RADTEIKTPMKEGIVDDWDAMEHIWDHALNKVLAIEMDEHPLLITEHTWNTRQNRQKAMELAFEKVQVPAFYTVKSPVAS IFASGKGSGLVVDIGHSIVSVTPVIDGLPLYKPSRRSLYAGDFLSQQVRHNLETQYTEKYPYLKTAVNTPRYLIASRKIP IEMGKPAQVVLKKFPNAIVAGVPTQSFRDFEIYRVLDEFKESILQVSDTPFKAAEMEDSVIPRTFEFPDGSNYEFKNERF QISESLFKPKNFPYPGFPVPSSTSATTEAVTSSLLPANKADEEEKEDEEKKEDVGGDSSTTAVKEEKSTLHESIEPAASK EAPAATTGSTDSTSKDGAATSTTTTTSGGATSTGAAAPSSTNTSSSSQQATPAYMLNDIRPVPPFSQTLGISELIVSSIN ACDVDARANLANNIVITGGSSLIQGLTDRINQDLSIMMPGLKIRLYAPGNLTERNYSAWVGGSILASLGTFHQLWISKRE YDEVGPDKLLDRRFR
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.