Protein
MCA_04332_1
Length
85 amino acids
Browser: contigC:2730435-2730823+
RNA-seq: read pairs 347, FPKM 49.9, percentile rank 65.4% (100% = highest expression)
Protein function
| EGGNOG: | 0PS0P | FG06318.1 | BolA domain protein |
|---|---|---|---|
| SGD closest match: | S000003188 | BOL2 | BolA-like protein 2 |
| CGD closest match: | CAL0000192500 | CAALFM_CR00430CA | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_01528_1 | 79.22% | 77 | 1e-40 | MIA_01528_1 |
| A0A0J9XFZ9_GEOCN | 69.14% | 81 | 1e-39 | Similar to Saccharomyces cerevisiae YGL220W FRA2 Protein involved in negative regulation of transcription of iron regulon OS=Geotrichum candidum GN=BN980_GECA14s02419g PE=3 SV=1 |
| A0A1E3PQ65_9ASCO | 68.35% | 79 | 2e-38 | Bola-like protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49999 PE=3 SV=1 |
| A0A1E4THE9_9ASCO | 65.88% | 85 | 6e-37 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_25336 PE=3 SV=1 |
| UniRef50_A0A1D2V9A1 | 67.95% | 78 | 7e-31 | Bola-domain-containing protein n=1 Tax=Ascoidea rubescens DSM 1968 TaxID=1344418 RepID=A0A1D2V9A1_9ASCO |
| Q6C8D7_YARLI | 64.56% | 79 | 2e-34 | YALI0D20504p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D20504g PE=3 SV=1 |
| A0A1D8PRQ4_CANAL | 65.38% | 78 | 5e-33 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR00430CA PE=3 SV=1 |
| BOL2_YEAST | 46.99% | 83 | 4e-22 | BolA-like protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BOL2 PE=1 SV=1 |
| A0A167FRZ5_9ASCO | 36.90% | 84 | 1e-10 | Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_3265 PE=3 SV=1 |
| A0A060T992_BLAAD | 38.10% | 63 | 1e-09 | ARAD1D16654p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D16654g PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.4075
Protein family membership
- BolA protein (IPR002634)
Domains and repeats
None predicted.
Detailed signature matches
-
-
SSF82657 (BolA-like)
-
PIRSF003113 (BolA)
-
PF01722 (BolA)
-
no IPR
Unintegrated signatures
Protein sequence
>MCA_04332_1 MSITSEYLDNAIRSRLQATHVECLDTSGGCGQAFQVIIVSPIFQGKNRLMRHRLVNTALKEEINSIHAFTQKNFTPDEWD KLQTS
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.