Protein
MCA_04303_1
Length
298 amino acids
Gene name: ASF1
Description: Histone chaperone ASF1
Browser: contigC:2646894-2648021-
RNA-seq: read pairs 572, FPKM 23.6, percentile rank 46.0% (100% = highest expression)
Protein function
Annotation: | ASF1 | Histone chaperone ASF1 | |
---|---|---|---|
KEGG: | K10753 | ASF1 | histone chaperone ASF1 |
EGGNOG: | 0PI2N | ASF1 | Histone chaperone that facilitates histone deposition and histone exchange and removal during nucleosome assembly and disassembly |
SGD closest match: | S000003651 | ASF1 | Histone chaperone ASF1 |
CGD closest match: | CAL0000179732 | ASF1 | Histone chaperone ASF1 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_04913_1 | 82.95% | 176 | 2e-100 | MIA_04913_1 |
A0A1E3PMN7_9ASCO | 81.97% | 183 | 1e-100 | Histone chaperone OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_22742 PE=3 SV=1 |
A0A060T5N1_BLAAD | 80.77% | 182 | 5e-99 | Histone chaperone OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C06336g PE=3 SV=1 |
UniRef50_A0A0L0P8I8 | 78.98% | 176 | 2e-91 | Histone chaperone n=16 Tax=Ascomycota TaxID=4890 RepID=A0A0L0P8I8_9ASCO |
ASF1_YARLI | 79.66% | 177 | 4e-93 | Histone chaperone ASF1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ASF1 PE=3 SV=1 |
ASF1_CANAL | 76.14% | 176 | 1e-92 | Histone chaperone ASF1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASF1 PE=3 SV=1 |
ASF1_YEAST | 77.27% | 176 | 5e-91 | Histone chaperone ASF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASF1 PE=1 SV=1 |
A0A0J9X9X5_GEOCN | 81.10% | 164 | 2e-89 | Histone chaperone OS=Geotrichum candidum GN=BN980_GECA06s04212g PE=3 SV=1 |
A0A1E4TM77_9ASCO | 68.00% | 175 | 5e-81 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_14960 PE=4 SV=1 |
A0A167FHG3_9ASCO | 79.07% | 43 | 4e-14 | Nucleosome assembly factor ASF1 OS=Sugiyamaella lignohabitans GN=ASF1 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0199
Protein family membership
- Histone chaperone ASF1-like (IPR006818)
- Histone deposition protein Asf1 (IPR017282)
Domains and repeats
None predicted.
Detailed signature matches
-
-
-
PIRSF037759 (Asf1)
-

Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_04303_1 MSIVSLLNVSVLNNPAKFTDPYKFEITFECLEPLKEDLEWKLTYVGSSTSFEHDQELDSLLVGPVPVGVNKFLFEADPPS PDLIPSSELVSVTVILLSCSYSDREFVRVGYVVNNEYDSEELRLNPPSLSGISETKKAEMVQHIVRNILAEKPRVTRFNI VWDNEDPNAEFPPEQPDADLVDEEDEIYGESEIEDEEEEEEEEEAEEAEESAAKPDNEEEEDLAENEEADEEDIEEEEEE EEEEEGGDDIEVDLEQESDSEKPKTEEDAAATTKEEATTTTTTEKSSTKAEDDKTTKE
GO term prediction
Biological Process
GO:0006333 chromatin assembly or disassembly
GO:0006334 nucleosome assembly
GO:0006337 nucleosome disassembly
GO:0016573 histone acetylation
Molecular Function
GO:0042393 histone binding
Cellular Component
GO:0005634 nucleus