Protein

MCA_04281_1

Length
514 amino acids

Gene name: TRM12

Description: tRNA wybutosine-synthesizing protein 2

Browser: contigC:2575486-2577031-

RNA-seq: read pairs 596, FPKM 14.3, percentile rank 33.0% (100% = highest expression)

Protein function

Annotation:TRM12tRNA wybutosine-synthesizing protein 2
KEGG:K07055TRM12 tRNA wybutosine-synthesizing protein 2 [EC:2.5.1.114]
EGGNOG:0PN2XFG01465.1tRNA wybutosine-synthesizing protein
SGD closest match:S000004464TRM12tRNA wybutosine-synthesizing protein 2
CGD closest match:CAL0000179804TRM12tRNA wybutosine-synthesizing protein 2

Protein alignments

%idAln lengthE-value
MIA_02285_141.78%3593e-88MIA_02285_1
UniRef50_A0A1E3QG0732.41%5405e-72tRNA wybutosine-synthesizing protein 2 n=1 Tax=Lipomyces starkeyi NRRL Y-11557 TaxID=675824 RepID=A0A1E3QG07_LIPST
A0A1E3PJM9_9ASCO32.95%4375e-65Uncharacterized protein (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_7519 PE=4 SV=1
A0A161HH75_9ASCO30.47%5484e-63tRNA wybutosine-synthesizing protein 2 OS=Sugiyamaella lignohabitans GN=TRM12 PE=3 SV=1
A0A060T791_BLAAD30.39%5102e-52tRNA wybutosine-synthesizing protein 2 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D01474g PE=3 SV=1
A0A0J9XDT8_GEOCN41.73%2667e-48Similar to Saccharomyces cerevisiae YML005W TRM12 S-adenosylmethionine-dependent methyltransferase of the seven beta-strand family OS=Geotrichum candidum GN=BN980_GECA11s01231g PE=4 SV=1
A0A1E4TKC7_9ASCO33.81%3498e-51Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_16425 PE=4 SV=1
TYW2_YEAST28.73%5366e-47tRNA wybutosine-synthesizing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM12 PE=1 SV=1
Q6CAM4_YARLI30.06%5093e-44tRNA wybutosine-synthesizing protein 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D01485g PE=3 SV=1
A0A1D8PKC5_CANAL27.68%5134e-40tRNA wybutosine-synthesizing protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRM12 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1948

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 350 400 450 514

Detailed signature matches

  1. Family IPR026274
    tRNA wybutosine synthesizing protein 2
    1. PIRSF038972 (Trm12)
  2. Domain IPR029063
    S-adenosyl-L-methionine-dependent methyltransferase
    1. SSF53335 (S-adenosy...)
  3. Domain IPR030382
    SAM-dependent methyltransferase TRM5/TYW2-type
    1. PF02475 (Met_10)
    2. PS51684 (SAM_MT_TRM...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.40.50...

Protein sequence

>MCA_04281_1
MNQHKWALQVTDNKLIKQIKTQLENEKLISKVSKITRQQDNSFLIPLSITSPDQLPSHFQNHGLISVSTADEINKNDSTF
HKNTCSSIISQILDSPDIKLPPGVSKQQLIDSFPHRYQLYEPLILFSAGTLSNNPLWSPLLHSQGSSNSLKFFSLLCEKF
SSLNKSQTFTHVAENAPISDKNDILRLPSKIIPLYPLNSSDKATDFDNLWVHTTQNGIHQTWSPAHTMFSRGNIKEKARV
LKFAKETINLYSAAYNNNGKGDDNNNIFLQKNEKYRLALVQWEGRPMAVDMYAGIGYFTFSYLKAGFSAVLCWELNPWSI
KGLLMGSGLNGWDSQLFVTQTEKEDESGSSNENDPINPVTRFDKKLFAKFLYSDSSRTKKNNKIAVFQEDNIMSLERIKS
AVEEYKRQHQTVYSPLIAHINLGLLPTTNLAWPTAVEIALYSSAPQVYLHIHANLSPNEMDPWIESTIKQLQSLIKTLSE
ETTKSLVSFIHLEKIKTYAPGVWHICGDFLIDKN

GO term prediction

Biological Process

GO:0031591 wybutosine biosynthetic process

Molecular Function

GO:0008757 S-adenosylmethionine-dependent methyltransferase activity

Cellular Component

None predicted.