Protein

MCA_04277_1

Length
304 amino acids


Gene name: MRPL10

Description: 54S ribosomal protein L10, mitochondrial

Browser: contigC:2568332-2569247+

RNA-seq: read pairs 5923, FPKM 240.0, percentile rank 90.1% (100% = highest expression)

Protein function

Annotation:MRPL1054S ribosomal protein L10, mitochondrial
KEGG:K02876RP-L15 large subunit ribosomal protein L15
EGGNOG:0PJUAMRPL10mitochondrial 54S ribosomal protein YmL10 YmL18
SGD closest match:S000005228MRPL1054S ribosomal protein L10, mitochondrial
CGD closest match:CAL0000178174MRPL10Mitochondrial 54S ribosomal protein YmL10/YmL18

Protein alignments

%idAln lengthE-value
MIA_02289_161.09%2752e-115MIA_02289_1
A0A0J9X5W2_GEOCN64.73%2751e-113Similar to Saccharomyces cerevisiae YNL284C MRPL10 Mitochondrial ribosomal protein of the large subunit OS=Geotrichum candidum GN=BN980_GECA02s06390g PE=3 SV=1
UniRef50_A0A0J9X5W264.73%2753e-110Similar to Saccharomyces cerevisiae YNL284C MRPL10 Mitochondrial ribosomal protein of the large subunit n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9X5W2_GEOCN
A0A060T3Q2_BLAAD54.51%2552e-85ARAD1C35552p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C35552g PE=3 SV=1
A0A167D010_9ASCO57.35%2043e-79Mitochondrial 54S ribosomal protein YmL10/YmL18 OS=Sugiyamaella lignohabitans GN=MRPL10 PE=3 SV=1
A0A1E3PGH4_9ASCO47.15%2632e-76Ribosomal protein L15 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83488 PE=3 SV=1
RM10_YEAST46.44%2672e-6154S ribosomal protein L10, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL10 PE=1 SV=2
A0A1E4TIU0_9ASCO50.00%2043e-53Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30012 PE=3 SV=1
Q59ZI7_CANAL40.89%2471e-51Mitochondrial 54S ribosomal protein YmL10/YmL18 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MRPL10 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9918
Predicted cleavage: 48

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 304

Detailed signature matches

    1. MF_01341 (Ribosomal...)
    1. PF00828 (Ribosomal_...)
    2. SSF52080 (Ribosomal...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_04277_1
MFYNRLTCSSKSSPISFLMRKSNVLPSFVSTFKGQQSRSLSLLGKLGDAKGAQKNEKRLGRGPGSGHGKTSGRGQKGQKA
RNSIKSWFEGGQTPIYKLFPKRGFKSHIDQPQYLNLSRLQYFIDNKRIDPTKPITMREIFQSGLLSSVKPGGVKIIAGGS
FRLRQPINLSASKASRAAIEAIENMGGTFTAQYYTGFGLKVLANPENALRRFARIPLRAKPISRKNIEYYRDPENRGYYQ
DSVAPQIIPARPKGSRSSTVKQSPLFELLAELESQEATPNAALDGFVSSAVIGGAAYRKKQKSA

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0015934 large ribosomal subunit