Protein

MCA_04261_1

Length
226 amino acids

Description: protein with ribosomal L9/ ribonuclease H1 domain

Browser: contigC:2520324-2521005-

RNA-seq: read pairs 24, FPKM 1.3, percentile rank 10.1% (100% = highest expression)

Protein function

Annotation:protein with ribosomal L9/ ribonuclease H1 domain

Protein alignments

%idAln lengthE-value
UniRef50_D0NEW437.84%1116e-08Putative uncharacterized protein n=4 Tax=Phytophthora TaxID=4783 RepID=D0NEW4_PHYIT

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9732
Predicted cleavage: 80

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 226

Detailed signature matches

  1. Family IPR017290
    Ribonuclease H, Bacteroides-type
    1. PIRSF037839 (RNase_H)
  2. Domain IPR009027
    Ribosomal protein L9/RNase H1, N-terminal
    1. SSF55658 (L9 N-doma...)
  3. Domain IPR011320
    Ribonuclease H1, N-terminal
    1. PF01693 (Cauli_VI)
    2. G3DSA:3.40.97...

Protein sequence

>MCA_04261_1
MKPSFSRFYYGYSNNLFSALLPLQNGLIKSRAARIYPISSWRNHHPLLQKNNALMLLSPLLRPRQQQHLRHLTTHETEDL
YDTDVKFVSLTKSLLQYKKYYVVKRGRAPGIYVDHEQAKNQVLGFSDGFMKVFKDLLQAIKFYSSNNNTVDNSKQTVQKR
TKTPTYYVVSKGKTPGIYLSLQEAEMENKGCSNYEIRVLDDLQLASSFLDHVIDINDLEKIKKSIQ

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0004523 RNA-DNA hybrid ribonuclease activity

Cellular Component

None predicted.