Protein

MCA_04258_1

Length
292 amino acids

Browser: contigC:2510771-2511650-

RNA-seq: read pairs 1492, FPKM 62.9, percentile rank 70.3% (100% = highest expression)

Protein function

EGGNOG:0PNNIPGUG_04968conserved hypothetical protein
CGD closest match:CAL0000190230orf19.2001Uncharacterized protein

Protein alignments

%idAln lengthE-value
MIA_00503_154.66%3112e-106MIA_00503_1
A0A0J9XDL8_GEOCN43.38%3254e-79Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA11s01418g PE=4 SV=1
UniRef50_A0A0J9XDL843.38%3259e-76Uncharacterized protein n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XDL8_GEOCN
A0A1E3PQ21_9ASCO40.65%2781e-56Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_22365 PE=4 SV=1
A0A1D8PGA7_CANAL41.88%2342e-48Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2001 PE=4 SV=1
Q6C0K2_YARLI34.17%2782e-43YALI0F23969p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F23969g PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0387

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 50 100 150 200 250 292

Detailed signature matches

  1. Domain IPR005123
    Oxoglutarate/iron-dependent dioxygenase
    1. PS51471 (FE2OG_OXY)
    2. PF13640 (2OG-FeII_O...)
  2. Domain IPR006620
    Prolyl 4-hydroxylase, alpha subunit
    1. SM00702 (p4hc)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:2.60.12...
  2. mobidb-lite (disord...)

Protein sequence

>MCA_04258_1
MAKKPKSTKQNGVPSTKANSSQSKTPSVDWPLNLVSFQVNPYQQVETVIEDQIYTLPKFFSAKLCNELIRWFETASNLKP
DTPKNKQVLDFVTTQMPPKKDYAARVNDRAVVYDKLLAYKLWQQLRIPLLSLPTPITTNGYETYGDDYNDNDNLDDDSLR
LRKIFQDCIGLNDNFRIYRYVPGHYFGQHYDESVKASVVKLDDSGKPSKPIEGNTLWTLLIYLTGEPEGEVTGGATTFYP
DETAGETDAVRVQLQKGTLLLHKHGDDCYLHEGELVKSGVKWVFRSDLVFPL

GO term prediction

Biological Process

GO:0055114 oxidation-reduction process

Molecular Function

GO:0005506 iron ion binding
GO:0016491 oxidoreductase activity
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0031418 L-ascorbic acid binding

Cellular Component

None predicted.