Protein
MCA_04252_1
Length
101 amino acids
Description: Putative NADH dehydrogenase (ubiquinone) subunit
Browser: contigC:2495589-2496010+
RNA-seq: read pairs 4814, FPKM 583.2, percentile rank 94.9% (100% = highest expression)
Protein function
| Annotation: | Putative NADH dehydrogenase (ubiquinone) subunit | ||
|---|---|---|---|
| KEGG: | K03965 | NDUFB9 | NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 9 |
| EGGNOG: | 0PQYY | LYR family | |
| CGD closest match: | CAL0000174836 | orf19.5547 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_02197_1 | 75.79% | 95 | 9e-50 | MIA_02197_1 |
| A0A0J9XDD7_GEOCN | 64.65% | 99 | 2e-43 | NI2M subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I), putative OS=Geotrichum candidum GN=BN980_GECA09s00604g PE=3 SV=1 |
| UniRef50_A0A0J9XDD7 | 64.65% | 99 | 3e-40 | NI2M subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I), putative n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XDD7_GEOCN |
| A0A060SXC5_BLAAD | 60.22% | 93 | 6e-37 | ARAD1A03036p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A03036g PE=3 SV=1 |
| Q6C9Z1_YARLI | 44.33% | 97 | 5e-29 | YALI0D07216p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D07216g PE=3 SV=2 |
| A0A1E4TCQ0_9ASCO | 52.33% | 86 | 3e-26 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_140497 PE=3 SV=1 |
| A0A1D8PPZ0_CANAL | 40.91% | 88 | 2e-21 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5547 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9370
Predicted cleavage: 17
Protein family membership
- Complex 1 LYR protein (IPR008011)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF05347 (Complex1_LYR)
-
Protein sequence
>MCA_04252_1 MVNESHRRLVSSLYRQSLRISKSWINRRDLWREKAVQIRKQFDDYKDVTDPRTIHYLVAKTEAMLKKYEHPDPIIPPLRP GGTKYERNVAAPTGEILKQDI
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.