Protein
MCA_04211_1
Length
111 amino acids
Gene name: MRP17
Description: 37S ribosomal protein MRP17, mitochondrial
Browser: contigC:2364171-2364595+
RNA-seq: read pairs 2475, FPKM 273.0, percentile rank 91.2% (100% = highest expression)
Protein function
| Annotation: | MRP17 | 37S ribosomal protein MRP17, mitochondrial | |
|---|---|---|---|
| KEGG: | K02990 | RP-S6 | small subunit ribosomal protein S6 |
| EGGNOG: | 0PQFB | MRP17 | mitochondrial 37S ribosomal protein YmS16 |
| SGD closest match: | S000001486 | MRP17 | 37S ribosomal protein MRP17, mitochondrial |
| CGD closest match: | CAL0000191831 | MRP17 | Mitochondrial 37S ribosomal protein YmS16 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_02694_1 | 58.33% | 108 | 9e-42 | MIA_02694_1 |
| A0A0J9XF23_GEOCN | 54.95% | 111 | 5e-41 | Similar to Saccharomyces cerevisiae YKL003C MRP17 Mitochondrial ribosomal protein of the small subunit OS=Geotrichum candidum GN=BN980_GECA12s03277g PE=4 SV=1 |
| UniRef50_A0A0J9XF23 | 54.95% | 111 | 9e-38 | Similar to Saccharomyces cerevisiae YKL003C MRP17 Mitochondrial ribosomal protein of the small subunit n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9XF23_GEOCN |
| A0A060T8C3_BLAAD | 52.38% | 105 | 2e-38 | ARAD1C35706p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C35706g PE=4 SV=1 |
| Q6C7J8_YARLI | 46.79% | 109 | 3e-30 | YALI0E00220p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E00220g PE=4 SV=2 |
| RT06_YEAST | 51.49% | 101 | 5e-29 | 37S ribosomal protein MRP17, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRP17 PE=1 SV=1 |
| Q5A4Z9_CANAL | 45.10% | 102 | 3e-26 | Mitochondrial 37S ribosomal protein YmS16 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MRP17 PE=4 SV=1 |
| A0A1E3PFJ4_9ASCO | 46.46% | 99 | 6e-26 | Ribosomal protein S6 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47454 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0591
Predicted cleavage: 12
Protein family membership
- Ribosomal protein S6 (IPR000529)
Domains and repeats
-
Domain
1
20
40
60
80
100
111
Detailed signature matches
no IPR
Unintegrated signatures
-
cd15465 (bS6_mito)
Residue annotation
-
rRNA binding site ...
-
S18 interface cd15...
Protein sequence
>MCA_04211_1 MLYELVGISRVPVTMKKEILEETRQILTTIGKSIIDNRGVIREIDNWGIKPLPKIMKKDRQQFAIGAYFYMKFDASPAVQ TEIARTLRMDPRMIRSTIVRVGGSTIGTLAQ
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Cellular Component
GO:0005840 ribosome