Protein
MCA_04194_1
Length
173 amino acids
Description: Putative NADH dehydrogenase (ubiquinone) subunit
Browser: contigC:2318655-2319262-
RNA-seq: read pairs 9216, FPKM 654.4, percentile rank 95.4% (100% = highest expression)
Protein function
| Annotation: | Putative NADH dehydrogenase (ubiquinone) subunit | ||
|---|---|---|---|
| KEGG: | K03952 | NDUFA8 | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 8 |
| EGGNOG: | 0PP5V | FG09547.1 | NADH-ubiquinone oxidoreductase 20.8 kDa subunit |
| CGD closest match: | CAL0000189366 | CAALFM_CR02620CA | NADH-ubiquinone oxidoreductase |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_02629_1 | 92.49% | 173 | 2e-122 | MIA_02629_1 |
| A0A0J9X8Y6_GEOCN | 80.35% | 173 | 3e-107 | NADH-ubiquinone oxidoreductase OS=Geotrichum candidum GN=BN980_GECA05s05884g PE=3 SV=1 |
| A0A060SWX7_BLAAD | 71.35% | 171 | 2e-94 | NADH-ubiquinone oxidoreductase OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A08998g PE=3 SV=1 |
| A0A161HG64_9ASCO | 70.93% | 172 | 5e-89 | NADH-ubiquinone oxidoreductase OS=Sugiyamaella lignohabitans GN=AWJ20_2275 PE=3 SV=1 |
| UniRef50_R1GCL1 | 70.00% | 150 | 8e-76 | NADH-ubiquinone oxidoreductase n=8 Tax=leotiomyceta TaxID=716546 RepID=R1GCL1_BOTPV |
| Q6CGB4_YARLI | 64.78% | 159 | 7e-78 | NADH-ubiquinone oxidoreductase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A20680g PE=3 SV=2 |
| A0A1E4THC3_9ASCO | 62.28% | 167 | 3e-75 | NADH-ubiquinone oxidoreductase OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_117615 PE=3 SV=1 |
| Q5A222_CANAL | 52.60% | 154 | 4e-56 | NADH-ubiquinone oxidoreductase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR02620CA PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1407
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
-
-
PIRSF017016 (NDUA8)
-
no IPR
Unintegrated signatures
-
PS51808 (CHCH)
Protein sequence
>MCA_04194_1 MTSREVVNDHRLLIDKTPLPDHIPQVPEIGATTAPLLSASFFIGARCLPYNDDYMMCKKEANGTGEIDCLKEGRRVTRCA ISVLEDINKHCIEEFRLHWQCLEQQNHQFSGCRPAERLLNKCVFDKLKLEKTIPGTPEGQVPVHLKEKPIIRPNTEDYAS VKAFQKAKSDGLI
GO term prediction
Biological Process
GO:0006120 mitochondrial electron transport, NADH to ubiquinone
Molecular Function
None predicted.
Cellular Component
GO:0005747 mitochondrial respiratory chain complex I