Protein

MCA_04176_2

Length
191 amino acids

Browser: contigC:2279864-2280804-

RNA-seq: read pairs 56008, FPKM 3604.4, percentile rank 98.9% (100% = highest expression)

Protein function

KEGG:K02997RP-S9e small subunit ribosomal protein S9e
EGGNOG:0PG10RPS940S ribosomal protein S9
SGD closest match:S000000393RPS9B40S ribosomal protein S9-B
CGD closest match:CAL0000197665RPS9BRibosomal 40S subunit protein S9B

Protein alignments

%idAln lengthE-value
A0A0J9XFQ5_GEOCN91.48%1762e-115Similar to Saccharomyces cerevisiae YBR189W RPS9B Protein component of the small (40S) ribosomal subunit,nearly identical to Rps9Ap OS=Geotrichum candidum GN=BN980_GECA15s00098g PE=4 SV=1
A0A1D8PGY8_CANAL88.70%1773e-114Ribosomal 40S subunit protein S9B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS9B PE=4 SV=1
A0A060T9K9_BLAAD88.33%1803e-114ARAD1D19162p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D19162g PE=4 SV=1
A0A1E3PN93_9ASCO87.78%1805e-114Ribosomal protein S4 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_41411 PE=4 SV=1
A0A1E4TBY4_9ASCO89.83%1771e-113Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3855 PE=4 SV=1
RS9B_YEAST86.03%1791e-11140S ribosomal protein S9-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS9B PE=1 SV=4
UniRef50_O1351685.47%1794e-10840S ribosomal protein S9-A n=141 Tax=Eukaryota TaxID=2759 RepID=RS9A_YEAST
Q6C2S5_YARLI85.47%1796e-110YALI0F05544p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F05544g PE=4 SV=1
MIA_02428_190.45%1578e-102MIA_02428_1
A0A167FVP5_9ASCO25.95%1314e-08Imp3p OS=Sugiyamaella lignohabitans GN=IMP3 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.4177

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 20 40 60 80 100 120 140 160 180 191

Detailed signature matches

  1. Family IPR005710
    Ribosomal protein S4/S9, eukaryotic/archaeal
    1. TIGR01018
  2. Domain IPR001912
    Ribosomal protein S4/S9, N-terminal
    1. SM01390 (Ribosomal_...)
  3. Domain IPR002942
    RNA-binding S4 domain
    1. PF01479 (S4)
    2. G3DSA:3.10.29...
    3. PS50889 (S4)
  4. SITE IPR018079
    Ribosomal protein S4, conserved site
    1. PS00632 (RIBOSOMAL_S4)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF55174 (Alpha-L R...)
  2. cd00165 (S4)
  3. mobidb-lite (disord...)

Residue annotation

  1. RNA binding surfac...

Protein sequence

>MCA_04176_2
MPRAPRSYSKTYSVPRRPYDTSRLDAELKLAGEYGLRNKREIYRIGLQLSKIRRAARDLLTRDEKDPKRLFEGNALIRRL
VRVGVLSEDKMKLDYVLALTIEDFLERRLQTQVFKLGLAKSVHHARVLIRQRHIRVGKQMVNVPSFMVRLDSQKHIDFAS
TSPYGGGRAGRVKRRNQAKSAGGEDGAEDEE

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding

Cellular Component

GO:0005622 intracellular
GO:0015935 small ribosomal subunit