Protein
MCA_04124_1
Length
73 amino acids
Browser: contigC:2117100-2117382+
RNA-seq: read pairs 194, FPKM 32.4, percentile rank 54.9% (100% = highest expression)
Protein function
| KEGG: | K18633 | MZT1 | mitotic-spindle organizing protein 1 |
|---|
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_02681_1 | 57.63% | 59 | 2e-19 | MIA_02681_1 |
| A0A0J9XFT9_GEOCN | 47.62% | 63 | 2e-18 | Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA15s00824g PE=4 SV=1 |
| UniRef50_P0CP05 | 40.32% | 62 | 2e-11 | Mitotic-spindle organizing protein 1 n=34 Tax=Fungi TaxID=4751 RepID=MZT1_CRYNB |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0171
Protein family membership
- Mitotic-spindle organizing protein 1 (IPR022214)
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MCA_04124_1 MNDPNQQEQSLHQKSKRTLDTLYEISQIMGTGLDKSSLAICVSLCEQGVPPENVASAIMYLKQKKQELSNAER
GO term prediction
Biological Process
GO:0033566 gamma-tubulin complex localization
Molecular Function
None predicted.
Cellular Component
GO:0008274 gamma-tubulin ring complex