Protein
MCA_04120_1
Length
125 amino acids
Gene name: QCR6
Description: Cytochrome b-c1 complex subunit 6
Browser: contigC:2110881-2111339-
RNA-seq: read pairs 26777, FPKM 2625.9, percentile rank 98.2% (100% = highest expression)
Protein function
| Annotation: | QCR6 | Cytochrome b-c1 complex subunit 6 | |
|---|---|---|---|
| KEGG: | K00416 | QCR6 | ubiquinol-cytochrome c reductase subunit 6 |
| EGGNOG: | 0PR41 | QCR6 | Ubiquinol-cytochrome C reductase |
| SGD closest match: | S000001929 | QCR6 | Cytochrome b-c1 complex subunit 6 |
| CGD closest match: | CAL0000176689 | orf19.913.2 | Ubiquinol--cytochrome-c reductase subunit 6 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_02677_1 | 71.97% | 132 | 4e-44 | MIA_02677_1 |
| A0A0J9X842_GEOCN | 72.58% | 124 | 1e-42 | Similar to Saccharomyces cerevisiae YFR033C QCR6 Subunit 6 of the ubiquinol cytochrome-c reductase complex OS=Geotrichum candidum GN=BN980_GECA04s02375g PE=4 SV=1 |
| A0A1E3PCH0_9ASCO | 64.57% | 127 | 5e-40 | Non-heme 11 kDa protein of cytochrome bc1 complex OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84590 PE=4 SV=1 |
| UniRef50_A0A1E3PRK3 | 75.71% | 70 | 4e-32 | Non-heme 11 kDa protein of cytochrome bc1 complex n=1 Tax=Nadsonia fulvescens var. elongata DSM 6958 TaxID=857566 RepID=A0A1E3PRK3_9ASCO |
| Q6C0H4_YARLI | 56.93% | 137 | 1e-31 | YALI0F24673p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F24673g PE=4 SV=1 |
| A0A161HLW5_9ASCO | 72.46% | 69 | 7e-31 | Ubiquinol--cytochrome-c reductase subunit 6 OS=Sugiyamaella lignohabitans GN=QCR6 PE=4 SV=1 |
| A0A060SZ66_BLAAD | 68.18% | 66 | 2e-27 | ARAD1C02838p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C02838g PE=4 SV=1 |
| A0A1E4TEU4_9ASCO | 56.25% | 128 | 1e-23 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_56779 PE=4 SV=1 |
| A0A1D8PJT8_CANAL | 54.93% | 71 | 7e-21 | Ubiquinol--cytochrome-c reductase subunit 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.913.2 PE=4 SV=1 |
| QCR6_YEAST | 63.46% | 52 | 7e-18 | Cytochrome b-c1 complex subunit 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QCR6 PE=1 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2673
Protein family membership
None predicted.
Domains and repeats
-
Domain
-
Domain
1
20
40
60
80
100
125
Detailed signature matches
-
-
SSF48371 (ARM repeat)
-
no IPR
Unintegrated signatures
-
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_04120_1 MSTFASLISDLAESLLPTVAFAEEEEEEKEEEEEQEEEEEDEEDEDDDEDDEPEDPFPALREAAAEGVCHSFKHHFDECV ERVTAAQQEPGYADLDYKEDCVEEFFHLEHCINDQTAGALFKLLK
GO term prediction
Biological Process
None predicted.
Molecular Function
GO:0005488 binding
Cellular Component
None predicted.