Protein

MCA_04097_1

Length
431 amino acids

Gene name: MET17

Description: Homocysteine/cysteine synthase

Browser: contigC:2009279-2010575+

RNA-seq: read pairs 26250, FPKM 750.8, percentile rank 95.7% (100% = highest expression)

Protein function

Annotation:MET17Homocysteine/cysteine synthase
KEGG:K17069MET17 O-acetylhomoserine/O-acetylserine sulfhydrylase [EC:2.5.1.49 2.5.1.47]
EGGNOG:0QDTPMET17o-acetylhomoserine
SGD closest match:S000004294MET17Homocysteine/cysteine synthase
CGD closest match:CAL0000188058MET15Bifunctional cysteine synthase/O-acetylhomoserine aminocarboxypropyltransferase

Protein alignments

%idAln lengthE-value
MIA_04712_182.41%4150.0MIA_04712_1
A0A0J9X8D9_GEOCN77.01%4350.0Similar to Saccharomyces cerevisiae YLR303W MET17 Methionine and cysteine synthase (O-acetyl homoserine-O-acetyl serine sulfhydrylase) OS=Geotrichum candidum GN=BN980_GECA04s03783g PE=3 SV=1
A0A1E4TFZ9_9ASCO70.49%4100.0Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_109355 PE=3 SV=1
A0A167FL49_9ASCO69.25%4130.0Bifunctional cysteine synthase/O-acetylhomoserine aminocarboxypropyltransferase MET17 OS=Sugiyamaella lignohabitans GN=MET17 PE=3 SV=1
CYSD_YEAST67.61%4230.0Homocysteine/cysteine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET17 PE=1 SV=3
UniRef50_P0610667.61%4230.0Homocysteine/cysteine synthase n=230 Tax=root TaxID=1 RepID=CYSD_YEAST
A0A1E3PRA4_9ASCO67.15%4140.0O-acetylhomoserine ami OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_22106 PE=3 SV=1
A0A060TA38_BLAAD67.15%4140.0ARAD1B04532p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B04532g PE=3 SV=1
Q6C7U9_YARLI66.01%4090.0YALI0D25168p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D25168g PE=3 SV=1
Q59US5_CANAL66.59%4223e-177Bifunctional cysteine synthase/O-acetylhomoserine aminocarboxypropyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MET15 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0449

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 400 431

Detailed signature matches

  1. Family IPR000277
    Cys/Met metabolism, pyridoxal phosphate-dependent enzyme
    1. cd00614 (CGS_like)
    2. PIRSF001434 (CGS)
    3. PS00868 (CYS_MET_ME...)
    4. PF01053 (Cys_Met_Me...)
  2. Family IPR006235
    O-acetylhomoserine/O-acetylserine sulfhydrylase
    1. TIGR01326
  3. Domain IPR015421
    Pyridoxal phosphate-dependent transferase, major region, subdomain 1
    1. G3DSA:3.40.64...
  4. Domain IPR015424
    Pyridoxal phosphate-dependent transferase
    1. SSF53383 (PLP-depen...)
  5. Domain IPR015422
    Pyridoxal phosphate-dependent transferase, subdomain 2
    1. G3DSA:3.90.11...

Residue annotation

  1. homodimer interfac...
  2. pyridoxal 5'-phosp...
  3. substrate-cofactor...
  4. catalytic residue ...

Protein sequence

>MCA_04097_1
MPSHFDTLQLHAGQTVDSDVRARAVPIYATTSYVFKNSQHGADLFSLKEPGYIYSRIMNPTTDVFEKRVAALEGGVGALA
VSSGQAAQFIAIAGVAKAGENIISTSYLYGGTYNQLKVTLKRLGIETQFVTEDSPEAFEKLINEKTRAIYLESISNPKYI
VPDIERISEIAHKHGIPVIVDNTFGAGGYYIQPLSLGADIVVHSATKWIGGHGTTIGGVIVDGGKFAWDQHVDKFPHLTE
PAEAYHGLSYTKALGNSVAFITFCRTELLRDLGPQLNPFGTFLLTQGLETLSLRAERHAENALKLAQYLEKNQYVNWVLY
PGLASHPSHELAKKHLKRGFGGVLSIGVKDGKGEQVVDALKLASNLANVGDSKTLVIAPFYTTHAQLSEKEKGESGVTED
LIRISVGTEFIDDIIADFDQAFAAVYDSAKL

GO term prediction

Biological Process

GO:0006520 cellular amino acid metabolic process

Molecular Function

GO:0003824 catalytic activity
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
GO:0030170 pyridoxal phosphate binding

Cellular Component

None predicted.