Protein
MCA_04087_2
Length
137 amino acids
Gene name: RPS17B
Description: 40S ribosomal protein S17-B
Browser: contigC:1979715-1980383-
RNA-seq: read pairs 39924, FPKM 3574.7, percentile rank 98.9% (100% = highest expression)
Protein function
| Annotation: | RPS17B | 40S ribosomal protein S17-B | |
|---|---|---|---|
| KEGG: | K02962 | RP-S17e | small subunit ribosomal protein S17e |
| EGGNOG: | 0PMV6 | RPS17 | 40s ribosomal protein S17 |
| SGD closest match: | S000002855 | RPS17B | 40S ribosomal protein S17-B |
| CGD closest match: | CAL0000195565 | RPS17B | Ribosomal 40S subunit protein S17B |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_04764_1 | 86.13% | 137 | 1e-84 | MIA_04764_1 |
| A0A0J9XI12_GEOCN | 86.96% | 138 | 1e-83 | Similar to Saccharomyces cerevisiae YDR447C RPS17B Ribosomal protein 51 (Rp51) of the small (40s) subunit, nearly identical to Rps17Ap OS=Geotrichum candidum GN=BN980_GECA18s01759g PE=3 SV=1 |
| A0A167E8E6_9ASCO | 81.16% | 138 | 3e-77 | Ribosomal 40S subunit protein S17B OS=Sugiyamaella lignohabitans GN=RPS17B PE=3 SV=1 |
| A0A060T6W7_BLAAD | 81.29% | 139 | 2e-74 | ARAD1B22792p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B22792g PE=3 SV=1 |
| A0A1E3PF15_9ASCO | 80.58% | 139 | 3e-74 | Putative 40S ribosomal protein S17 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_43808 PE=3 SV=1 |
| RS17B_YEAST | 79.56% | 137 | 4e-74 | 40S ribosomal protein S17-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS17B PE=1 SV=1 |
| Q6C1P8_YARLI | 78.99% | 138 | 7e-74 | YALI0F14465p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F14465g PE=3 SV=1 |
| UniRef50_P02407 | 79.41% | 136 | 9e-70 | 40S ribosomal protein S17-A n=253 Tax=Opisthokonta TaxID=33154 RepID=RS17A_YEAST |
| A0A1D8PEY9_CANAL | 73.72% | 137 | 8e-70 | Ribosomal 40S subunit protein S17B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS17B PE=3 SV=1 |
| A0A1E4TK01_9ASCO | 75.19% | 133 | 2e-64 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_42616 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.5892
Protein family membership
- Ribosomal protein S17e (IPR001210)
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MCA_04087_2 MGRVRTKTVKRAAKQMIEGYYPKLTLDFEVNKRLADEVAYIPSKRLRNKIAGYTTHLMKRIQKGPVRGISFKLQEEERER RDQYVPEVSALDLSRSDGALDVDRETAELLKSLGLKLAVNVHPVSASSTERRYRKRN
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome