Protein

MCA_04050_1

Length
220 amino acids


Browser: contigC:1877791-1878524-

RNA-seq: read pairs 681, FPKM 38.1, percentile rank 59.3% (100% = highest expression)

Protein alignments

%idAln lengthE-value
A0A1E3PIN0_9ASCO38.27%812e-06Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51746 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0520
Predicted cleavage: 13

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. PF15454 (LAMTOR)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_04050_1
MGAVFSCLRGRSDSSTESNGERAPLLNDDTPRYDSNTIDSNSYNNPLKTDSDRREKDLNTILKTVDDFLINISSVEQPNL
PEMSRRTLMEYKLAFSGRKKLSPNLGAVSEPNSRSNPSSAEEKHFHKDSDNHYEHSHRASSISSFSKQKPKSKSAAKPKP
FRPTTKVPINDMSNGEWLIVTNSVPEKDKIWIKKISQEASSLYNNEKIVQPVGKLMFTFS

GO term prediction

Biological Process

GO:0001919 regulation of receptor recycling
GO:0007040 lysosome organization
GO:0032008 positive regulation of TOR signaling
GO:0032439 endosome localization
GO:0042632 cholesterol homeostasis
GO:0043410 positive regulation of MAPK cascade
GO:0071230 cellular response to amino acid stimulus

Molecular Function

None predicted.

Cellular Component

GO:0031902 late endosome membrane
GO:0045121 membrane raft
GO:0071986 Ragulator complex