MCA_04050_1
Browser: contigC:1877791-1878524-
RNA-seq: read pairs 681, FPKM 38.1, percentile rank 59.3% (100% = highest expression)
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A1E3PIN0_9ASCO | 38.27% | 81 | 2e-06 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51746 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0520
Predicted cleavage: 13
Protein family membership
- LAMTOR1/MEH1 (IPR028209)
Domains and repeats
Detailed signature matches
-
-
PF15454 (LAMTOR)
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_04050_1 MGAVFSCLRGRSDSSTESNGERAPLLNDDTPRYDSNTIDSNSYNNPLKTDSDRREKDLNTILKTVDDFLINISSVEQPNL PEMSRRTLMEYKLAFSGRKKLSPNLGAVSEPNSRSNPSSAEEKHFHKDSDNHYEHSHRASSISSFSKQKPKSKSAAKPKP FRPTTKVPINDMSNGEWLIVTNSVPEKDKIWIKKISQEASSLYNNEKIVQPVGKLMFTFS
GO term prediction
Biological Process
GO:0001919 regulation of receptor recycling
GO:0007040 lysosome organization
GO:0032008 positive regulation of TOR signaling
GO:0032439 endosome localization
GO:0042632 cholesterol homeostasis
GO:0043410 positive regulation of MAPK cascade
GO:0071230 cellular response to amino acid stimulus
Molecular Function
None predicted.
Cellular Component
GO:0031902 late endosome membrane
GO:0045121 membrane raft
GO:0071986 Ragulator complex