Protein
MCA_04039_1
Length
317 amino acids
Gene name: CAR1
Description: Arginase
Browser: contigC:1834249-1835203+
RNA-seq: read pairs 1821, FPKM 70.8, percentile rank 72.9% (100% = highest expression)
Protein function
| Annotation: | CAR1 | Arginase | |
|---|---|---|---|
| KEGG: | K01476 | E3.5.3.1 | arginase [EC:3.5.3.1] |
| EGGNOG: | 0PFFU | CAR1 | arginase |
| SGD closest match: | S000006032 | CAR1 | Arginase |
| CGD closest match: | CAL0000174553 | CAR1 | Arginase |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_00793_1 | 77.67% | 318 | 0.0 | MIA_00793_1 |
| A0A0J9X9Y4_GEOCN | 70.66% | 317 | 2e-168 | Arginase OS=Geotrichum candidum GN=BN980_GECA06s03409g PE=3 SV=1 |
| Q6C6P6_YARLI | 63.41% | 317 | 1e-146 | Arginase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E07535g PE=3 SV=1 |
| A0A167E7D0_9ASCO | 64.72% | 309 | 1e-145 | Arginase OS=Sugiyamaella lignohabitans GN=CAR1 PE=3 SV=1 |
| A0A060T2B6_BLAAD | 61.59% | 315 | 3e-143 | Arginase OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C24046g PE=3 SV=1 |
| A0A1E3PE58_9ASCO | 63.67% | 311 | 3e-139 | Arginase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48097 PE=3 SV=1 |
| A0A1E4TH23_9ASCO | 55.15% | 330 | 2e-130 | Arginase OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_116001 PE=3 SV=1 |
| UniRef50_J4GRK7 | 53.87% | 310 | 3e-110 | Arginase n=12 Tax=Basidiomycota TaxID=5204 RepID=J4GRK7_9APHY |
| A0A1D8PP00_CANAL | 47.45% | 314 | 2e-101 | Arginase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAR1 PE=3 SV=1 |
| ARGI_YEAST | 47.13% | 331 | 8e-99 | Arginase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAR1 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2424
Protein family membership
- Ureohydrolase (IPR006035)
- Arginase (IPR014033)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PS01053 (ARGINASE_1)
-
no IPR
Unintegrated signatures
Residue annotation
-
Mn binding site cd...
-
active site cd09989
-
oligomer interface...
Protein sequence
>MCA_04039_1 MSFDERFPDRKLQVISAPFSGGQPKGGVDDGPQHLLDAGLLDTLKTLGWNPEFEGHLNFPRPASDPPIGVVKNARYVSAT TKIVYEKVAEACQQGKFPLTIGGDHSIAIGTVAGVQQKYPDACVIWIDAHADINTPQDSESGNLHGCPLSFVLGLAEPLK SDNKDEADLFGWVPHCLDTSRLAYIALRDLDAYEKKLLKDKHIAAYTMRHVDQYGIGKVVDMAIRAVNPHNKRPIHLSFD IDALDPFFAPATGTAVRGGLTWREGCYICEAVAETGNLVAMDLVEVNPHLGEKEEASALTTSTGISLVKSALGDVLL
GO term prediction
Biological Process
GO:0006525 arginine metabolic process
Molecular Function
GO:0004053 arginase activity
GO:0016813 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines
GO:0046872 metal ion binding
Cellular Component
None predicted.