Protein

MCA_04007_1

Length
518 amino acids


Gene name: TIM54

Description: Mitochondrial import inner membrane translocase subunit TIM54

Browser: contigC:1761964-1763521+

RNA-seq: read pairs 3209, FPKM 76.4, percentile rank 74.5% (100% = highest expression)

Protein function

Annotation:TIM54Mitochondrial import inner membrane translocase subunit TIM54
KEGG:K17792TIM54 mitochondrial import inner membrane translocase subunit TIM54
EGGNOG:0PGC5TIM54mitochondrial import inner membrane translocase subunit TIM54
SGD closest match:S000003590TIM54Mitochondrial import inner membrane translocase subunit TIM54
CGD closest match:CAL0000174120TIM54Mitochondrial import inner membrane translocase subunit TIM54

Protein alignments

%idAln lengthE-value
MIA_05850_159.92%4890.0MIA_05850_1
A0A0J9X883_GEOCN45.64%5391e-137Similar to Saccharomyces cerevisiae YJL054W TIM54 Component of the mitochondrial TIM22 complex involved in insertion of polytopic proteins into the inner membrane OS=Geotrichum candidum GN=BN980_GECA05s01121g PE=4 SV=1
UniRef50_A0A0J9X88345.64%5393e-134Similar to Saccharomyces cerevisiae YJL054W TIM54 Component of the mitochondrial TIM22 complex involved in insertion of polytopic proteins into the inner membrane n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X883_GEOCN
A0A161HJB1_9ASCO42.12%4829e-115Tim54p OS=Sugiyamaella lignohabitans GN=TIM54 PE=4 SV=1
A0A1E3PF43_9ASCO41.01%4954e-112Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84065 PE=4 SV=1
A0A060TG51_BLAAD46.27%2682e-72ARAD1D20372p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D20372g PE=4 SV=1
A0A1E4TAX6_9ASCO47.83%2074e-62Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_20078 PE=4 SV=1
TIM54_CANAL43.05%2232e-60Mitochondrial import inner membrane translocase subunit TIM54 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIM54 PE=3 SV=3
TIM54_YARLI64.44%1352e-52Mitochondrial import inner membrane translocase subunit TIM54 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIM54 PE=3 SV=1
TIM54_YEAST51.16%1292e-37Mitochondrial import inner membrane translocase subunit TIM54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM54 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0153

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)
  2. mobidb-lite (disord...)

Protein sequence

>MCA_04007_1
MDSSKPSTEPTGSSVPPPEQPKASTAPAPKPKPKGYTNPALQAMGIPRLRLPSRNWMIFWCVVGGVSGLIVYDRRQRQAR
RQFWKDQVAPFSQVPLDAMELPRKVTVYMAPPPNDYLDVSQKHFRQYIKPILTSAAVDYQVVSETRQGEIRAKVAEEIRN
KRRAKRGLPTSDADENNFKDEVDLQIERGINRDKTGGVLCIGRGAYKEYINGLQEGWLGPLEPPKEILEAEKNNDKVKDI
SVESLDAATTSETTQSTDTPHQVISSEIPQAATTSKEQEEASMFPNEEADQRDVLGYSDEKKAPEGESTEEKPAEEAEKD
KRPPVPKPYILGMNRGAKVWGSELPEGADADLLAATPEEVSDPIAVLEFRNLLGFTTIPTRIMRFFSRRELSDKLGKDTA
VVVFNEYRPFRNEVDENSVFMSETDDFSNSNDSAARTSDVDALINEELKDWPSKFKQKAIDNNSEWMWPFSVDPRLSSKL
RIYSPTPALLQKFEEAKNSKGEKKVEVIEDKPSNKDVD

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.