Protein
MCA_04004_1
Length
175 amino acids
Gene name: ENV10
Description: SRP-independent targeting protein 2
Browser: contigC:1755681-1756209+
RNA-seq: read pairs 746, FPKM 52.4, percentile rank 66.3% (100% = highest expression)
Protein function
| Annotation: | ENV10 | SRP-independent targeting protein 2 | |
|---|---|---|---|
| EGGNOG: | 0PRIK | FG05494.1 | Protein of unknown function (DUF788) |
| SGD closest match: | S000004055 | ENV10 | SRP-independent targeting protein 2 |
| CGD closest match: | CAL0000175736 | orf19.4528 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_05847_1 | 60.00% | 165 | 1e-56 | MIA_05847_1 |
| A0A0J9X7M0_GEOCN | 57.86% | 140 | 2e-53 | Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA04s06236g PE=4 SV=1 |
| UniRef50_A0A0J9X7M0 | 57.86% | 140 | 3e-50 | Uncharacterized protein n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9X7M0_GEOCN |
| A0A060T7Y7_BLAAD | 48.70% | 154 | 1e-48 | ARAD1C25630p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C25630g PE=4 SV=1 |
| A0A1E3PSF8_9ASCO | 39.61% | 154 | 3e-40 | DUF788-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_44940 PE=4 SV=1 |
| A0A1E4TFN4_9ASCO | 44.44% | 153 | 4e-39 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_108063 PE=4 SV=1 |
| Q59TA3_CANAL | 43.40% | 159 | 9e-38 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.4528 PE=4 SV=1 |
| Q6C821_YARLI | 39.10% | 133 | 1e-30 | YALI0D23441p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D23441g PE=4 SV=1 |
| ENV10_YEAST | 28.26% | 138 | 3e-08 | SRP-independent targeting protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENV10 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9199
Predicted cleavage: 42
Protein family membership
- SRP-independent targeting protein 2/TMEM208 (IPR008506)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
-
mobidb-lite (disord...)
Protein sequence
>MCA_04004_1 MANASAKKQAISNTNALKLMHLSALGVNAFVFLFHFLLKRPASLKPYLLFSIPAFLLQFQLERMGRPSYDEKGSLIKAGD DLGAPGITEWMHDVIYVTWGCAILSAVFNSTKVWFVYLVIPLYASYKLYSFISAQSGGFFNGGRPAQVPEQQQPGVSKRQ EKLQKKRQKFSQSIS
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.