Protein

MCA_03952_1

Length
164 amino acids

Gene name: ARC19

Description: Actin-related protein 2/3 complex subunit 4

Browser: contigC:1603489-1604069+

RNA-seq: read pairs 7768, FPKM 581.7, percentile rank 94.9% (100% = highest expression)

Protein function

Annotation:ARC19Actin-related protein 2/3 complex subunit 4
KEGG:K05755ARPC4 actin related protein 2/3 complex, subunit 4
EGGNOG:0PFJRARC19Arp2 3 complex 20 kDa subunit
SGD closest match:S000001496ARC19Actin-related protein 2/3 complex subunit 4
CGD closest match:CAL0000200234ARC19Actin-related protein 2/3 complex subunit 4

Protein alignments

%idAln lengthE-value
MIA_00072_186.83%1672e-102MIA_00072_1
A0A0J9X998_GEOCN92.90%1552e-101Actin-related protein 2/3 complex subunit 4 OS=Geotrichum candidum GN=BN980_GECA05s06236g PE=3 SV=1
A0A060TIQ7_BLAAD90.20%1532e-97Actin-related protein 2/3 complex subunit 4 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D39908g PE=3 SV=1
UniRef50_A0A0C4ECF781.94%1558e-89Actin-related protein 2/3 complex subunit 4 n=144 Tax=Opisthokonta TaxID=33154 RepID=A0A0C4ECF7_MAGP6
A0A1E3PH08_9ASCO83.87%1553e-91Actin-related protein 2/3 complex subunit 4 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47308 PE=3 SV=1
Q6CAH1_YARLI80.65%1555e-89Actin-related protein 2/3 complex subunit 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D02805g PE=3 SV=2
A0A1E4TJK4_9ASCO77.42%1557e-85Actin-related protein 2/3 complex subunit 4 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_512 PE=3 SV=1
ARPC4_YEAST72.44%1562e-74Actin-related protein 2/3 complex subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARC19 PE=1 SV=2
A0A1D8PRU4_CANAL75.47%1591e-73Actin-related protein 2/3 complex subunit 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARC19 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0596

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR034666
    Arp2/3 complex subunit 2/4
    1. G3DSA:3.30.14...
    2. SSF69645 (Arp2/3 co...)
  2. Family IPR008384
    Actin-related protein 2/3 complex subunit 4
    1. PIRSF039100 (ARPC4)
    2. PF05856 (ARPC4)
Unintegrated signatures no IPR
Unintegrated signatures
  1. NON_CYTOPLASM... (N...)
  2. SIGNAL_PEPTIDE (Sig...)
  3. SIGNAL_PEPTID... (S...)
  4. SIGNAL_PEPTID... (S...)
  5. SIGNAL_PEPTID... (S...)

Protein sequence

>MCA_03952_1
MVSSQKYMFSLTAALCLENFASQTVERHNTPEVEIGTTPEALLNPLTIARNENEKVLIEPSINSVRLSIKIKQADEIENI
LVRQFARFLTGRAEAFFILRRKPIADYDISFLITNYHTEQMLKHKLVDFIIEFMEEVDKEISEMKLFLNARARFVAEAYL
TPFD

GO term prediction

Biological Process

GO:0030041 actin filament polymerization
GO:0030833 regulation of actin filament polymerization
GO:0034314 Arp2/3 complex-mediated actin nucleation

Molecular Function

None predicted.

Cellular Component

GO:0005885 Arp2/3 protein complex
GO:0015629 actin cytoskeleton