Protein

MCA_03949_1

Length
486 amino acids

Gene name: UBP6

Description: Ubiquitin carboxyl-terminal hydrolase 6; Ubiquitin-specific protease; situated in the base subcomplex of the 26S proteasome

Browser: contigC:1598464-1600083-

RNA-seq: read pairs 5045, FPKM 128.0, percentile rank 82.7% (100% = highest expression)

Protein function

Annotation:UBP6Ubiquitin carboxyl-terminal hydrolase 6; Ubiquitin-specific protease; situated in the base subcomplex of the 26S proteasome
KEGG:K11843USP14 ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
EGGNOG:0PITPUBP6ubiquitin carboxyl-terminal hydrolase
SGD closest match:S000001906UBP6Ubiquitin carboxyl-terminal hydrolase 6
CGD closest match:CAL0000193223UBP6Ubiquitin-specific protease

Protein alignments

%idAln lengthE-value
MIA_00075_167.95%4930.0MIA_00075_1
A0A0J9XA95_GEOCN58.20%4880.0Similar to Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific protease situated in the base subcomplex of the 26S proteasome OS=Geotrichum candidum GN=BN980_GECA05s06269g PE=3 SV=1
A0A1E3PPG5_9ASCO56.56%4880.0Cysteine proteinase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49566 PE=3 SV=1
A0A167EML0_9ASCO54.15%5063e-178Ubp6p OS=Sugiyamaella lignohabitans GN=UBP6 PE=3 SV=1
UniRef50_A0A167EML054.15%5069e-175Ubp6p n=1 Tax=Sugiyamaella lignohabitans TaxID=796027 RepID=A0A167EML0_9ASCO
A0A060TD12_BLAAD55.34%4598e-170ARAD1D39842p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D39842g PE=3 SV=1
Q6CAG8_YARLI56.11%4838e-167YALI0D02871p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D02871g PE=3 SV=1
A0A1E4TJN9_9ASCO48.56%4866e-147Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_513 PE=3 SV=1
A0A1D8PC77_CANAL40.49%4895e-111Ubiquitin-specific protease OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UBP6 PE=3 SV=1
UBP6_YEAST38.83%3583e-64Ubiquitin carboxyl-terminal hydrolase 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP6 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1537

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 350 400 450 486

Detailed signature matches

  1. Domain IPR029071
    Ubiquitin-related domain
    1. SSF54236 (Ubiquitin...)
  2. Domain IPR000626
    Ubiquitin domain
    1. SM00213 (ubq_7)
    2. PF00240 (ubiquitin)
    3. PS50053 (UBIQUITIN_2)
  3. Domain IPR028889
    Ubiquitin specific protease domain
    1. PS50235 (USP_3)
  4. Domain IPR001394
    Peptidase C19, ubiquitin carboxyl-terminal hydrolase
    1. PF00443 (UCH)
  5. SITE IPR018200
    Ubiquitin specific protease, conserved site
    1. PS00972 (USP_1)
    2. PS00973 (USP_2)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. G3DSA:3.10.20.90
  3. G3DSA:3.90.70.10
  4. SSF54001 (Cysteine ...)
  5. cd02657 (Peptidase_...)
  6. mobidb-lite (disord...)

Residue annotation

  1. Active Site cd02657

Protein sequence

>MCA_03949_1
MSDLPVVVRHAGKKYDVTVDLSEPGIVFKNQLYSLTGVSPERQKLLVKGGQLKDDADLSKLNWKPGQSLLMMGTAGELPK
EPTSKPKFIEDMSDFQIAQETKYPTGLVNLGNTCYMNSTLQALRTVPELRAALNSYQANASSNPMDLTNELKNLYKMMDG
GIGLPHSFLSVLTANFSQFAEQDEHGHPKQQDAEEAWSLLLNYLRGSLKNGDDNNSSAIDKYLSGTFETTLKSMETPEDE
PKIGEEQFFKLDCHISINTNFLKDGILDSLTEKIEKHNEKLGRDSEYQLVKRISRLPKYLTVHYVRFFWKRDVQKKSKIL
RKVVFPKQLDVTDLCSDDLRKKTIPVREKLYQIRKEEEEIRRAAKKAAATSSSNNGNNKSIKDAVPEEKKKEYREELEKV
IDPELKNDPGANNSGLYELQAVITHQGASADAGHYQAFVRNDNEEGQWWKFNDDKVTLVDESKIDALAGGGESDSALILL
YRSAGI

GO term prediction

Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process
GO:0016579 protein deubiquitination

Molecular Function

GO:0005515 protein binding
GO:0036459 thiol-dependent ubiquitinyl hydrolase activity

Cellular Component

None predicted.