Protein

MCA_03907_1

Length
715 amino acids

Gene name: NCP1

Description: NADPH--cytochrome P450 reductase

Browser: contigC:1463210-1465358-

RNA-seq: read pairs 5786, FPKM 99.8, percentile rank 78.6% (100% = highest expression)

Protein function

Annotation:NCP1NADPH--cytochrome P450 reductase
KEGG:K00327POR NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
EGGNOG:0PGVUNCP1This enzyme is required for electron transfer from NADP to cytochrome P450 (By similarity)
SGD closest match:S000001084NCP1NADPH--cytochrome P450 reductase
CGD closest match:CAL0000197218NCP1NADPH--cytochrome P450 reductase

Protein alignments

%idAln lengthE-value
MIA_03501_169.58%7200.0MIA_03501_1
A0A0J9XBI0_GEOCN65.15%7030.0NADPH--cytochrome P450 reductase OS=Geotrichum candidum GN=NCP1 PE=3 SV=1
A0A060T7I0_BLAAD61.01%7130.0NADPH--cytochrome P450 reductase OS=Blastobotrys adeninivorans GN=NCP1 PE=3 SV=1
A0A167CXE1_9ASCO60.22%7140.0NADPH--cytochrome P450 reductase OS=Sugiyamaella lignohabitans GN=NCP1 PE=3 SV=1
A0A1E3PCU8_9ASCO55.99%6680.0NADPH--cytochrome P450 reductase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NCP1 PE=3 SV=1
F2Z6C9_YARLI54.44%6980.0NADPH--cytochrome P450 reductase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NCP1 PE=3 SV=1
UniRef50_G2Q3U956.38%6580.0NADPH--cytochrome P450 reductase n=26 Tax=leotiomyceta TaxID=716546 RepID=G2Q3U9_MYCTT
A0A1E4TGH7_9ASCO49.58%7140.0NADPH--cytochrome P450 reductase OS=Tortispora caseinolytica NRRL Y-17796 GN=NCP1 PE=3 SV=1
A0A1D8PLR7_CANAL47.86%6790.0NADPH--cytochrome P450 reductase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NCP1 PE=3 SV=1
NCPR_YEAST41.48%6878e-171NADPH--cytochrome P450 reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCP1 PE=1 SV=3

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0095

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 100 200 300 400 500 600 715

Detailed signature matches

  1. Family IPR001094
    Flavodoxin-like
    1. PR00369 (FLAVODOXIN)
  2. Family IPR023208
    NADPH-cytochrome P450 reductase
    1. MF_03212 (NCPR)
    2. PIRSF000208 (P450R)
  3. Domain IPR029039
    Flavoprotein-like domain
    1. SSF52218 (Flavoprot...)
    2. G3DSA:3.40.50...
  4. Domain IPR008254
    Flavodoxin/nitric oxide synthase
    1. PS50902 (FLAVODOXIN...)
    2. PF00258 (Flavodoxin_1)
  5. Domain IPR017938
    Riboflavin synthase-like beta-barrel
    1. SSF63380 (Riboflavi...)
  6. Domain IPR017927
    Ferredoxin reductase-type FAD-binding domain
    1. PS51384 (FAD_FR)
  7. Domain IPR003097
    FAD-binding, type 1
    1. PF00667 (FAD_binding_1)
  8. Domain IPR001433
    Oxidoreductase FAD/NAD(P)-binding
    1. PF00175 (NAD_binding_1)
  9. Domain IPR001709
    Flavoprotein pyridine nucleotide cytochrome reductase
    1. PR00371 (FPNCR)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. G3DSA:2.40.30.10
  3. G3DSA:3.40.50.80
  4. NON_CYTOPLASM... (N...)
  5. SSF52343 (Ferredoxi...)
  6. TMhelix
  7. TRANSMEMBRANE (Tran...)
  8. cd06204 (CYPOR)

Residue annotation

  1. NADP binding pocke...
  2. FAD binding pocket...
  3. FAD binding motif ...
  4. catalytic residues...
  5. phosphate binding ...
  6. beta-alpha-beta st...

Protein sequence

>MCA_03907_1
MAQLDVLDLAVLAVLILGTAIYFFWDSITGSKAISPDEKYKDGFGQSSGSLSSRDIVETLESNDKDVIIFYGSQTGTAED
YASRIAKEASQVYGLKTMTASLEDYDFENLDAIPAGKVVGFVTATYGEGEPTDNAFAFYEFLTSEDVQFSQGDSLKGLKY
IVFGLGNSTYEHYNAVGRKIDSTLQAHGASRIGPYGEGDDGSGTMEEDFIAWKEQLFDCWKTEEGLEEHEAVYEPVLKII
PCDDLTIESDTVFLGEPNKAHLTKSVKAPYTATNPYIAPVLKTKEMFNSDSRHCIHMELDISGDKSFKYTTGDHLALISQ
NSNEEVNSFLSILGLESVKDNVFNVKNLDPTAKVPFPVPTTYDAVVRYHLEINGPVSRQFLSSIAPFAPSEEAKKNAQRL
GSSKDDFSAEVTKKYLNIARLLSQLSNGQPWKDVPFTFIIESIPHLVPRYYSISSSSKENPDVISITAVVESIEPEGSNH
VLKGVATNYILDIHNNINAKKNTDPNAVHYEIGGPRNLLEGKKVYAYVRHSSFKLPSNPKKPVIMIGPGTGVAPFRGFIR
ERAHVASKGTPVGPALLFFGCRKKNEDFLYEDEWTQFSKNTPSDLLNDYISLPEEEKSKAPLNQSSFLKVITAFSREGPE
KIYVQKRLEENAALVNALLKQGAFFYVCGDAMRMARDVQATLIKIISEQRSISKAKAEEIVKNMRTQNLYQEDVW

GO term prediction

Biological Process

GO:0055114 oxidation-reduction process

Molecular Function

GO:0003958 NADPH-hemoprotein reductase activity
GO:0010181 FMN binding
GO:0016491 oxidoreductase activity

Cellular Component

None predicted.