Protein

MCA_03832_1

Length
96 amino acids


Description: Protein with thioredoxin-like fold

Browser: contigC:1218913-1219279+

RNA-seq: read pairs 1264, FPKM 161.0, percentile rank 85.6% (100% = highest expression)

Protein function

Annotation:Protein with thioredoxin-like fold
EGGNOG:0PSUPglutaredoxin domain-containing protein
SGD closest match:S000002694YDR286CGlutaredoxin-like protein YDR286C
CGD closest match:CAL0000193978orf19.319Glutaredoxin-like protein

Protein alignments

%idAln lengthE-value
MIA_03782_173.68%951e-50MIA_03782_1
A0A0J9XEY4_GEOCN53.61%976e-34Glutaredoxin-like protein OS=Geotrichum candidum GN=BN980_GECA11s01605g PE=3 SV=1
UniRef50_A0A0J9XEY453.61%971e-30Glutaredoxin-like protein n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9XEY4_GEOCN
A0A1E3PER0_9ASCO56.70%972e-30Glutaredoxin-like protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_53349 PE=3 SV=1
A0A060T9M8_BLAAD48.28%872e-24Glutaredoxin-like protein OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D16236g PE=3 SV=1
YD286_YEAST36.78%871e-14Glutaredoxin-like protein YDR286C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR286C PE=3 SV=1
A0A1D8PJN7_CANAL41.10%734e-12Glutaredoxin-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.319 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9232
Predicted cleavage: 17

Protein family membership

Domains and repeats

  1. Domain
1 10 20 30 40 50 60 70 80 90 96

Detailed signature matches

    1. PF05768 (DUF836)
    1. SSF52833 (Thioredox...)
Unintegrated signatures no IPR
Unintegrated signatures

Protein sequence

>MCA_03832_1
MRYSAIRLFANKVTFFTRPNCGLCENAKAALSKAWDQSKTKFDYTEKDITKPENQEWFDKYAFDVPVVHFEKESDSKVTK
LMHRMTPEQILDIIDK

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.